DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and LIG4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001339533.1 Gene:LIG4 HGNCID:6601 Length:923 Species:Homo sapiens

Alignment Length:682 Identity:157/683 (23%)
Similarity:283/683 (41%) Gaps:133/683 (19%)


  Fly   130 LARTFQVIEETKGRLKMIDTLSNF------FCSVMLVSPEDLVPSVYLSINQLAPAY--EGLELG 186
            |..|.:.|:::|||.:.|.....|      |...:..:.:|:..|.|.::..:.|..  |.:..|
Human    31 LCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDVTDSFYPAMRLILPQLERERMAYG 95

  Fly   187 VAETTLMKAICK-----ATGRN---LAHIKSQTQLTGDLGIVAEQSR-VSQRMMFQPAPLNVRDV 242
            :.||.|.|...:     ..|::   |.:.::.|...||.|..|..:. |.:....|...|.::.|
Human    96 IKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHGDAGDFAMIAYFVLKPRCLQKGSLTIQQV 160

  Fly   243 FRKLREIAKLSGQSKMDLV----YNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLVK 303
            ...|..||..:...:.||:    ..:.....:.|.::.||.:|..|::|:::|::.:.......:
Human   161 NDLLDSIASNNSAKRKDLIKKSLLQLITQSSALEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAE 225

  Fly   304 KNHIDD-----CKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHP 363
            .:::..     |:....|.|   .:.|.::.|.:|:                             
Human   226 LHNVTTDLEKVCRQLHDPSV---GLSDISITLFSAF----------------------------- 258

  Fly   364 GMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEI-SIFSRNSENNTAKYPD 427
                :|||| ....:..:.:.........|.|.||||.|:|::  |:: ..||||..|    |.|
Human   259 ----KPMLA-AIADIEHIEKDMKHQSFYIETKLDGERMQMHKD--GDVYKYFSRNGYN----YTD 312

  Fly   428 LIARSTA----------LLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDI----EEI 478
            ....|..          ..|.|::..|:|.|::|::...:..:       :|....||    |:.
Human   313 QFGASPTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFM-------QKGTKFDIKRMVEDS 370

  Fly   479 KVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIK 543
            .:|.|..:||:|.:|...|..:.|.:|.::|...|..:.|..:.......:..:||...|.|:|.
Human   371 DLQTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNEAID 435

  Fly   544 GNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLA 608
            ...||:|||  ...:.|:..||...|||:|.:|:|.:.|.||::::|||.|||.|.|....||.|
Human   436 KREEGIMVK--QPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMMSHFLCA 498

  Fly   609 CYD-----TENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDP-------SLEPDH 661
            ..:     .:...:.::.::|:|.|.::|..    ||..:....|.::|..|       :.:|:.
Human   499 VAEKPPPGEKPSVFHTLSRVGSGCTMKELYD----LGLKLAKYWKPFHRKAPPSSILCGTEKPEV 559

  Fly   662 WFEPVQ--VWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENA---TDANQV- 720
            :.||..  :.::|.|::..|.:::.         |.:|||||..:|||||.....   .|..|: 
Human   560 YIEPCNSVIVQIKAAEIVPSDMYKT---------GCTLRFPRIEKIRDDKEWHECMTLDDLEQLR 615

  Fly   721 ---------AHMYQSQDQVKNNQKSSTQMEME 743
                     .|:|...|.....:|.....:|:
Human   616 GKASGKLASKHLYIGGDDEPQEKKRKAAPKMK 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 157/683 (23%)
DNA_ligase_A_N 126..292 CDD:282522 42/183 (23%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 60/233 (26%)
OBF_DNA_ligase_I 581..726 CDD:153438 44/172 (26%)
LIG4NP_001339533.1 dnl1 93..614 CDD:273147 138/586 (24%)
BRCT 668..742 CDD:306918
DNA_ligase_IV 762..795 CDD:314367
BRCT 841..910 CDD:306918
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.