DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and LIG3

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_005258027.1 Gene:LIG3 HGNCID:6600 Length:1018 Species:Homo sapiens

Alignment Length:829 Identity:207/830 (25%)
Similarity:347/830 (42%) Gaps:214/830 (26%)


  Fly     5 ITSFFKKKSDATDSPSPPKKVPKIDAKTELPDE------PHIKSESA----SPETKPKVEPMSVD 59
            |...|:|...|..:....:.:.:::...||.|.      .||...|:    :|:.|..|:.....
Human   149 IKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQHIADLSSKAAGTPKKKAVVQAKLTT 213

  Fly    60 SEEKTSPVK--------NVKK------EPK---EVDDKTTDKKVTTIGLNSTAATKEDVENYDPS 107
            :.:.|||||        |.:|      :|.   |.....|.|:       |.:::|.|..:.|..
Human   214 TGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAPSSPTPKR-------SLSSSKCDPRHKDCL 271

  Fly   108 ADSYHPL-----KNAYWKDKKVTPYLALARTFQVIEE--TKGRLKMIDTLSNFFCSVMLVSPEDL 165
            ...:..|     .|..:..|.           |:|::  .||.                 :.:..
Human   272 LREFRKLCAMVADNPSYNTKT-----------QIIQDFLRKGS-----------------AGDGF 308

  Fly   166 VPSVYLSINQLAPAYEGLELGVAETTLM---KAICKATGR-------NLAHIKSQTQLTGDLGIV 220
            ...|||::..|.|       ||.:|...   |.|.|...|       ::|....|..::..:.:.
Human   309 HGDVYLTVKLLLP-------GVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVF 366

  Fly   221 AEQSRVSQRMMFQPAP---LNVRDVFRKLREIAKLSGQ-SKMDLVYNMFVACRSSEARFFIRSLI 281
            .|||:     .|.||.   |.:::|...|..::||:.: .:...:.::...|.:::.:..||.:.
Human   367 FEQSK-----SFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIK 426

  Fly   282 GKLRIGIAEQSLLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPA 346
            ..|::....:.:|.||.                 |:.|:            |:....|...::..
Human   427 HDLKMNSGAKHVLDALD-----------------PNAYE------------AFKASRNLQDVVER 462

  Fly   347 ILKYDIKELQERCPMHPGM------------PLRPMLAQPTKGVHEVFERF-GGMQITCEWKYDG 398
            :| ::.:|:::    .||.            |::||||:..|.|....::. .||  ..|.||||
Human   463 VL-HNAQEVEK----EPGQRRALSVQASLMTPVQPMLAEACKSVEYAMKKCPNGM--FSEIKYDG 520

  Fly   399 ERAQIHRNEKGE-ISIFSRNSE----NNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQ 458
            ||.|:|:|  |: .|.|||:.:    :..|.:.|.|.::   ..|. .|.|:|||::..|.:..:
Human   521 ERVQVHKN--GDHFSYFSRSLKPVLPHKVAHFKDYIPQA---FPGG-HSMILDSEVLLIDNKTGK 579

  Fly   459 ILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFA 523
            .|||..|...|:....    ...||:::||.:|.|..:|:.:.|.||||.|.::..|:.....|:
Human   580 PLPFGTLGVHKKAAFQ----DANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIPNRIMFS 640

  Fly   524 ------TALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSN--V 580
                  .|||..|:  :.:.::|.:    |||::|  |.:.|||..|  |:|||:|||||:.  :
Human   641 EMKRVTKALDLADM--ITRVIQEGL----EGLVLK--DVKGTYEPGK--RHWLKVKKDYLNEGAM 695

  Fly   581 GDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTS 645
            .|:.||||:|.:.|:|.:.|....||:.|||..::::.::.|...|..|..|......|  .:..
Human   696 ADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGSQKWCTVTKCAGGHDDATLARLQNEL--DMVK 758

  Fly   646 AAKSYYRYDPSLEPDHWF---------------EPVQVWEVKCADLSLSPIHRAAIGIVDGERGI 695
            .:|     |||..|. |.               :...|||:..|:.|.|..|.|        .||
Human   759 ISK-----DPSKIPS-WLKVNKIYYPDFIVPDPKKAAVWEITGAEFSKSEAHTA--------DGI 809

  Fly   696 SLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQ------VKNNQKSST 738
            |:||||..||||||:.::||:..|:..:||...:      |..::.|||
Human   810 SIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTVVAGDEGSST 858

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 207/830 (25%)
DNA_ligase_A_N 126..292 CDD:282522 33/182 (18%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 77/242 (32%)
OBF_DNA_ligase_I 581..726 CDD:153438 51/160 (32%)
LIG3XP_005258027.1 zf-PARP 106..188 CDD:279039 7/39 (18%)
DNA_ligase_A_N 273..438 CDD:282522 36/205 (18%)
dnl1 327..839 CDD:273147 159/589 (27%)
Adenylation_DNA_ligase_III 477..689 CDD:185712 75/234 (32%)
OBF_DNA_ligase_III 695..833 CDD:153436 48/154 (31%)
LIG3_BRCT 942..1013 CDD:293364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.