DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and LIG1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_000225.1 Gene:LIG1 HGNCID:6598 Length:919 Species:Homo sapiens

Alignment Length:766 Identity:377/767 (49%)
Similarity:515/767 (67%) Gaps:47/767 (6%)


  Fly    10 KKKSDATDSP-SPPK--KVPKIDAKTELPDEPHIKSESASPETKPKVEPMSVDSEEKTSPVKN-- 69
            :|:.:..|.| :|||  |..|.:..||...||.:       .||.:::    :.||:|.|.:.  
Human   172 EKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEV-------ATKQELQ----EEEEQTKPPRRAP 225

  Fly    70 -------------VKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWKD 121
                         ||||.||.:.....|:       ..|....|...|:|:.::|||:::|.||.
Human   226 KTLSSFFTPRKPAVKKEVKEEEPGAPGKE-------GAAEGPLDPSGYNPAKNNYHPVEDACWKP 283

  Fly   122 KKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGLELG 186
            .:..||||:||||:.|||...||:|::||||...||:.:||.||:|.:|||:|.|.|..:|||||
Human   284 GQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELG 348

  Fly   187 VAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIAK 251
            |.:..|:||:.:||||.|..::::....||:|:|||.||.:||:|..|.||....||.|.|:||:
Human   349 VGDGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIAR 413

  Fly   252 LSGQS----KMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTAL--AIGLVKKNH---- 306
            |:|.:    |:|::..:|||||.|||||..|||.|:||:|:||||:|.||  |:.|.....    
Human   414 LTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPP 478

  Fly   307 -IDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPM 370
             :.|....|..:..|..:.:..::||..:|:.|:.|.|||.:|::.::.|.|.|.:.||:||:||
Human   479 AMVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPM 543

  Fly   371 LAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTAL 435
            ||.||:|:.||.:||.....|||:||||:|||||..|.||:.|||||.|:||.||||:|:|...:
Human   544 LAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKI 608

  Fly   436 LKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTK 500
            ....|.|:|:|:|.||||.|:|||.|||||:|||||.||..||:||||:|.|||:|:||.:||.:
Human   609 KLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVRE 673

  Fly   501 NLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKR 565
            .||.||:||.|:|.|.|||:.|||:|||.||:::.:|||:|:|.:||||||||||.:||||||||
Human   674 PLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKR 738

  Fly   566 SRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDE 630
            |.||||||||||..|||:|||||||.|.|:|:|.|.|||||||.||.::||.|:|||:||||:||
Human   739 SHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDE 803

  Fly   631 DLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGI 695
            :|:.|.:.|...|..:.:.|.|.|.::.||||.:|..||||||||||||||:.||.|:||.::||
Human   804 ELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGI 868

  Fly   696 SLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQMEMEDEF 746
            |||||||||:|:||..|.||.:.|||.:|:.|.|::|.|...:..:.||.:
Human   869 SLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY 919

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 377/764 (49%)
DNA_ligase_A_N 126..292 CDD:282522 89/170 (52%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 137/218 (63%)
OBF_DNA_ligase_I 581..726 CDD:153438 87/145 (60%)
LIG1NP_000225.1 DUF4045 <10..275 CDD:330572 31/121 (26%)
CDC9 164..914 CDD:330238 375/760 (49%)
Interaction with target DNA 449..458 6/9 (67%)
Interaction with target DNA 642..644 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332590368
eggNOG 1 0.900 E1_COG1793
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 731 1.000 Inparanoid score I600
Isobase 1 0.950 0 Normalized mean entropy S1058
OMA 1 1.010
OrthoDB 1 1.010 D182401at33208
OrthoFinder 1 1.000 FOG0003190
OrthoInspector 1 1.000 T1075342
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2092
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.