DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and DNAlig4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_572907.1 Gene:DNAlig4 FlyBaseID:FBgn0030506 Length:918 Species:Drosophila melanogaster

Alignment Length:634 Identity:150/635 (24%)
Similarity:247/635 (39%) Gaps:111/635 (17%)


  Fly   162 PEDLVPSVYLSINQLAPAYE------GLELGVAETTLMKAICKATGRNLAHIKSQTQ---LTGDL 217
            |||...|.|..:..|.|..:      ||::.......::.:...|..:.| |:.|.:   :..|.
  Fly    59 PEDGASSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDA-IRLQHRNGNMYRDY 122

  Fly   218 GIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIAKLSGQSKMDLVYNMFVACRSSEARFFIRSLIG 282
            |.|. .|.:..|....|:.|.::::.:.|..||....:.|...:..........|.::.||.|:.
  Fly   123 GDVV-YSVLKPRCFNPPSNLRLKEIHQMLDTIANEDTEVKQQQLIRFTEQASPEEQKWLIRLLLK 186

  Fly   283 KLRIGIAEQSLLTAL---AIGLVKK----NHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNY 340
            .|.:||.||.:...|   |..:.::    .|:.:..|.:..|:......|:...:|..     |.
  Fly   187 SLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAAVKFV-----NL 246

  Fly   341 DIIIPAILKYDIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGG-----MQ---ITCEWKYD 397
            :.:|.              |.|   .:||||.          |||.|     ||   :..|.|.|
  Fly   247 NSVIR--------------PFH---QIRPMLC----------ERFPGDIQELMQSDVLYLETKMD 284

  Fly   398 GERAQIHRNEKGEISIFSRNSENNTAKY------PDLIARSTALLKGDVKSYIIDSEIVAWDVER 456
            |||.|:| .::|.....|||..:.|..:      ..|..:...||...::|.|:|.|::.||..:
  Fly   285 GERFQLH-IDRGRFMYISRNGVDYTRNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNK 348

  Fly   457 KQILPFQVLSTRKRKNVDIEEIKV----QVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVE 517
               |.|:    .|.:|.|::.:|.    |.|..::||||.||.:|:.....:|...|.:...|..
  Fly   349 ---LRFR----EKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQS 406

  Fly   518 GEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKR-SRNWLKLKKDYLSNVG 581
            |..:...|.....:.|..:..::::..:.||:::|  .:.:.|:...| ...|.|.|.||:..:.
  Fly   407 GVLQLMRARKIGSVQEFNELFQQALDSHAEGIVLK--KQGSRYQPGVRLGGGWYKDKADYIKGLI 469

  Fly   582 DSLDLVVIGGYKGKGRRTGTY-GGFLLACY------DTENEEYQSICKIGTGFTDEDLQTHSEFL 639
            ...|:::||.:..:.|   |: ..|||...      .:...|..||..:........:..|:  |
  Fly   470 TEFDVLIIGAFYNRKR---TFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQRGVLNHT--L 529

  Fly   640 GKH----VTSAAKSYYRYDPSLE---PDHWFEPVQ--VWEVKCADLSLSPIHRAAIGIVDGERGI 695
            ..|    |......::.|.|...   ||.|.||..  :.:||.|||       |..|.....:  
  Fly   530 KPHWHDVVNEPPPLWFHYKPKERSGCPDLWIEPQNSVILQVKAADL-------APNGAFFTRK-- 585

  Fly   696 SLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQMEMED 744
            ||.|||....||||.........:...:......:|...|  .|:.:||
  Fly   586 SLHFPRTEMKRDDKTWSECMTLKEFNDLCGGPLAIKKLNK--RQLRLED 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 150/635 (24%)
DNA_ligase_A_N 126..292 CDD:282522 33/139 (24%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 64/237 (27%)
OBF_DNA_ligase_I 581..726 CDD:153438 38/161 (24%)
DNAlig4NP_572907.1 DNA_ligase_A_N 10..197 CDD:282522 33/140 (24%)
dnl1 84..613 CDD:273147 138/587 (24%)
Adenylation_DNA_ligase_IV 249..466 CDD:185713 66/254 (26%)
OBF_DNA_ligase_IV 469..607 CDD:153437 38/152 (25%)
BRCT 668..745 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105311841
eggNOG 1 0.900 E1_COG1793
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.