DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and Lig3

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_006247051.1 Gene:Lig3 RGDID:1309875 Length:1002 Species:Rattus norvegicus

Alignment Length:818 Identity:202/819 (25%)
Similarity:344/819 (42%) Gaps:191/819 (23%)


  Fly     5 ITSFFKKKSDATDSPSPPKKVPKIDAKTELPD------EPHI----KSESASPETKPKVEPMSVD 59
            |...|:|...|..:....:.:.:::...||.|      ..||    ...:|:|:.|..|:.....
  Rat   141 IKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQHIADLSSKTAATPKKKATVQAKLTT 205

  Fly    60 SEEKTSPVKNVKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWKDKKV 124
            :.:.|||||..     .....|..:|     .:..:|.|.:....|||:.:.....:|...|.|.
  Rat   206 TGQVTSPVKGA-----SFITSTNPRK-----FSGFSAAKPNNSEQDPSSPAPKTSLSASKCDPKH 260

  Fly   125 TPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSP---------EDLVP----------SVY 170
            ..  .|.|.|:.:                 |:::..:|         .|.:.          .||
  Rat   261 KD--CLLREFRKL-----------------CAMVAENPSYNTKTQIIHDFLQKGSTGDGFRGDVY 306

  Fly   171 LSINQLAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQ------TQLTGDL--GIVAEQSRV- 226
            |::..|.|.            ::|::.....:.:..:.|:      ..:..||  |.|:|..|| 
  Rat   307 LTVKLLLPG------------VIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVF 359

  Fly   227 -SQRMMFQPAP---LNVRDVFRKLREIAKLSGQ-SKMDLVYNMFVACRSSEARFFIRSLIGKLRI 286
             .|...|.||.   |.:::|...|..::||:.: .:...:.::...|.:::.:..||.:...|::
  Rat   360 FEQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKM 424

  Fly   287 GIAEQSLLTALAIGLVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYD 351
            ....:.:|.||.                 |:.|:            |:....|...::..:| ::
  Rat   425 NSGAKHVLDALD-----------------PNAYE------------AFKASRNLQDVVERVL-HN 459

  Fly   352 IKELQERCPMHPG------------MPLRPMLAQPTKGVHEVFERF-GGMQITCEWKYDGERAQI 403
            .:|:::    .||            .|::||||:..|.:....::. .||  ..|.||||||.|:
  Rat   460 EQEVEK----DPGRRRALSVQASLMTPVQPMLAEACKSIEYAMKKCPNGM--FSEIKYDGERVQV 518

  Fly   404 HRNEKGE-ISIFSRNSE----NNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQ 463
            |:  ||: .|.|||:.:    :..|.:.|.|.::   ..|. :|.|:|||::..|....:.|||.
  Rat   519 HK--KGDHFSYFSRSLKPVLPHKVAHFKDYIPKA---FPGG-QSMILDSEVLLIDNNTGKPLPFG 577

  Fly   464 VLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDT 528
            .|...|:....    ...||:::||.:|.|..:|:.:.|.||||.|.::..|:.....|:.....
  Rat   578 TLGVHKKAAFQ----DANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIRNRIMFSEMKQV 638

  Fly   529 NDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSN--VGDSLDLVVIGG 591
            ....::...:...|:...|||::|  |.:.|||..|  |:|||:|||||:.  :.|:.||||:|.
  Rat   639 TKASDLADMINRVIREGLEGLVLK--DVKGTYEPGK--RHWLKVKKDYLNEGAMADTADLVVLGA 699

  Fly   592 YKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPS 656
            :.|:|.:.|....||:.|||.:::::.::.|...|..|..|..    |.|.:.....|   .|||
  Rat   700 FYGQGSKGGMMSIFLMGCYDPDSQKWCTVTKCAGGHDDATLAR----LQKELDMVKIS---KDPS 757

  Fly   657 LEPDHWF---------------EPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIR 706
            ..|. |.               :...|||:..|:.|.|..|.|        .|||:||||..|||
  Rat   758 KIPS-WLKINKIYYPDFIVPDPKKAAVWEITGAEFSRSEAHTA--------DGISIRFPRCTRIR 813

  Fly   707 DDKNSENATDANQVAHMYQ-SQDQ-----VKNNQKSST 738
            |||:.::||:..|:..:|| |:|:     |..::.|||
  Rat   814 DDKDWKSATNLPQLKELYQLSKDKADFAVVAGDEGSST 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 202/819 (25%)
DNA_ligase_A_N 126..292 CDD:282522 33/199 (17%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 72/236 (31%)
OBF_DNA_ligase_I 581..726 CDD:153438 52/161 (32%)
Lig3XP_006247051.1 zf-PARP 98..178 CDD:279039 7/37 (19%)
DNA_ligase_A_N 266..431 CDD:282522 32/194 (16%)
dnl1 320..832 CDD:273147 155/578 (27%)
Adenylation_DNA_ligase_III 470..682 CDD:185712 70/228 (31%)
OBF_DNA_ligase_III 688..826 CDD:153436 49/154 (32%)
LIG3_BRCT 927..997 CDD:293364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.