DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and Lig4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001099565.1 Gene:Lig4 RGDID:1304639 Length:911 Species:Rattus norvegicus

Alignment Length:631 Identity:152/632 (24%)
Similarity:271/632 (43%) Gaps:104/632 (16%)


  Fly   126 PYLALARTFQVIEETKGRLKMIDTLSNF------FCSVMLVSPEDLVPSVYLSINQLAPAY--EG 182
            |:..|..|.:.|::.|.|.:.|.....|      |...:..:.:|:..|.|.::..:.|..  |.
  Rat    15 PFADLCSTLERIQKGKDRAEKIRHFKEFLDSWRKFHDALHKNKKDVPDSFYPAMRLILPQLERER 79

  Fly   183 LELGVAETTLMKAICK--------ATGRNLAHIKSQTQLTGDLGIVAEQSR-VSQRMMFQPAPLN 238
            :..|:.||.|.|...:        ...:.|.:.::.:....|.|..|..:. |.:....|...|.
  Rat    80 MAYGIKETMLAKLYIELLNLPREGKDAQKLLNYRTPSGARSDAGDFATIAYFVLKPRCLQKGSLT 144

  Fly   239 VRDVFRKLREIAKLSGQSKMDLV----YNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAI 299
            ::.|...|..:|..:...:.|||    ..:...|.:.|.::.||.:|..|::|:::.::|:....
  Rat   145 IQKVNELLDLVASNNSGKRKDLVKKSLLQLITQCSALEQKWLIRMIIKDLKLGVSQHTILSIFHN 209

  Fly   300 GLVKKNHIDD-----CKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERC 359
            ..|:.:::..     |:....|.|   .:.|.::.|.:|:                         
  Rat   210 DAVELHNVTTDLEKVCRQLHDPSV---GLSDISITLFSAF------------------------- 246

  Fly   360 PMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEI-SIFSRNSENNTA 423
                    ||||| ....|..|.:.........|.|.||||.|:|::  |.: ..||||..|.|.
  Rat   247 --------RPMLA-AVADVERVEKDMKQQSFYIETKLDGERMQMHKD--GALYRYFSRNGYNYTD 300

  Fly   424 KYPDLIARSTA------LLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQV 482
            ::.:.....:.      ..|.||:..|:|.|::|::...:..:...|....||.   :|:..:|.
  Rat   301 QFGESPQEGSLTPFIHNAFKTDVQVCILDGEMMAYNPTTQTFMQKGVKFDIKRM---VEDSDLQT 362

  Fly   483 CVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCE 547
            |..:||:|.:|...|..:.|.:|..:|...|..::|..:...........||...|.::|....|
  Rat   363 CYCVFDVLMVNNKKLGRETLRKRYDILSSTFTPIQGRIEIVQKTQAQTKQEVVDALNDAIDKREE 427

  Fly   548 GLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDT 612
            |:|||  ...:.|:..||...|||:|.:|::.:.|.|||:::|||.|||.|.|....||.|..:|
  Rat   428 GIMVK--HPLSIYKPDKRGEGWLKIKPEYVTGLMDELDLLIVGGYWGKGSRGGMMSHFLCAVAET 490

  Fly   613 -----ENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDP-------SLEPDHWFEP 665
                 :...:.::|::|:|:|.::|..    ||..:....|.:.|..|       :.:|:.:.||
  Rat   491 PPPGDKPSVFHTLCRVGSGYTMKELYD----LGLKLAKYWKPFQRKSPPSCILCGTEKPEVYIEP 551

  Fly   666 VQ--VWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDK 709
            ..  :.::|.|::..|.:::.         |.:|||||..:|||||
  Rat   552 QNSVIVQIKAAEIVPSDMYKT---------GSTLRFPRIEKIRDDK 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 152/632 (24%)
DNA_ligase_A_N 126..292 CDD:282522 39/187 (21%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 61/225 (27%)
OBF_DNA_ligase_I 581..726 CDD:153438 43/144 (30%)
Lig4NP_001099565.1 DNA_ligase_A_N 15..203 CDD:282522 39/188 (21%)
dnl1 81..602 CDD:273147 138/566 (24%)
Adenylation_DNA_ligase_IV 235..455 CDD:185713 65/261 (25%)
OBF_DNA_ligase_IV 459..596 CDD:153437 43/144 (30%)
BRCT 654..730 CDD:278934
DNA_ligase_IV 750..782 CDD:288294
BRCT <845..899 CDD:237994
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.