DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and adl1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_595345.1 Gene:adl1 PomBaseID:SPBC713.06 Length:774 Species:Schizosaccharomyces pombe

Alignment Length:759 Identity:249/760 (33%)
Similarity:419/760 (55%) Gaps:59/760 (8%)


  Fly     8 FFKKKSDATDSPSPPKKVPKIDAKT----------ELPDEPHIKSESASPETKPKVEPMSVDSEE 62
            |.|:::..||:|:  |.:...|...          :|.|.   ::::.:||..||  .:.:..||
pombe    33 FSKREAQLTDTPN--KLLTDHDQSASDYAYALKLQQLFDS---ENQATAPEKLPK--DVIIPEEE 90

  Fly    63 KTSPVKNVKKE----PKEVDDKTTDKKVTTIGLNSTAATKEDVENYDP-SADSYHPLKNA----Y 118
            ..:...||.||    |||  :..|.::......::.:..|:...:||. ..|....:|:.    .
pombe    91 YHTDTFNVVKESNDKPKE--NLVTSEECKASFFSTDSVNKDSTIDYDALQKDPLTYVKSCRARFV 153

  Fly   119 WKDKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGL 183
            .||.|...|.:||.||.:|..||.|::::..|:||..:::...|:.|:.:|:|..|.:||.:.|.
pombe   154 SKDTKSFSYSSLANTFSLISSTKSRIRIVTLLTNFLLTLLYADPDSLIATVWLCTNSIAPNFYGK 218

  Fly   184 ELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLRE 248
            .|||......||:.:..|...:.:|:.....||.|.||.:::||.|.:.:|.||.::.|:..|.:
pombe   219 NLGVGPAMYSKALKEVCGITASALKNLWNKYGDPGDVAFEAKVSVRTLSRPEPLTIKKVYSTLLK 283

  Fly   249 IAKLSGQS----KMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLV---KKNH 306
            ||..:|..    |::|...:.::..:.|.|:..||::..||||..:.::|.:|:....   .:|.
pombe   284 IADSNGNGAQNRKLELTKFLLISSNAEEVRYIGRSIMQNLRIGAVQNTMLASLSKAFFIFDNQNE 348

  Fly   307 IDDCKASKVPDVYK--DEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRP 369
            |.:..:..:...::  :|||      |.::.|.|:|:|::..:|:..|:.|::...:.||:|::|
pombe   349 IFNFNSDSLQQQFRQGEEIV------KQSFFQVPDYNILVATLLREGIENLKDNMSIRPGIPVKP 407

  Fly   370 MLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTA 434
            ||...||.:..:.||......:||:||||:|||||.:..|.|.||||:.|..|.::||:|..:..
pombe   408 MLGSITKNLQHMLERLTDHNFSCEFKYDGQRAQIHCDRLGNIKIFSRHLEEITGRFPDVIEVAQL 472

  Fly   435 LLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVT 499
            .||... .:||:.|:||.|....|||.||.||||:||.|.:.:|.:.|||::||:::.:|.:.:.
pombe   473 ALKHSC-DFIIEGELVAIDKSNGQILDFQKLSTRERKKVTVADITIDVCVFVFDIMFCDGKSCLQ 536

  Fly   500 KNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDE-----EAT 559
            ..|.|||::..|||..:...::|.::|:||:...:|:|...:|...|||||||.|:.     .:|
pombe   537 MPLIERRRMFFEHFNLIPNRFQFVSSLETNEEQSIQEFFSLAITNKCEGLMVKVLNGTNSKFPST 601

  Fly   560 YEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIG 624
            ||..||...|:|:|:|| .:..:|||||.||.:.|.||:.|.:...|||.|:.:...|:::||..
pombe   602 YEPDKRGEGWIKVKQDY-DDEFESLDLVPIGAWYGNGRKAGWFSPILLAVYNPDTGAYEAVCKCM 665

  Fly   625 TGFTDEDLQTHSEFLGKHV----TSAAKSYYRY--DPSLEPDHWFEPVQVWEVKCADLSLSPIHR 683
            :||:|   |.:.|...|:.    .|:.|..|.:  ...:.|..:|.|.:|||:|.|.::.||.::
pombe   666 SGFSD---QFYKELTQKYSLESGNSSLKPIYNFCETGKVTPQIYFAPQEVWEIKGAQITSSPAYK 727

  Fly   684 AAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQ 727
            ||:|::..:||:|:|||||||:|.||..|:|:..:.:|.||..|
pombe   728 AALGLIQDDRGLSIRFPRFIRVRSDKGPEDASTNSILADMYMKQ 771

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 249/760 (33%)
DNA_ligase_A_N 126..292 CDD:282522 53/170 (31%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 90/223 (40%)
OBF_DNA_ligase_I 581..726 CDD:153438 58/151 (38%)
adl1NP_595345.1 PLN03113 73..771 CDD:215584 239/713 (34%)
DNA_ligase_A_N 161..332 CDD:282522 53/171 (31%)
Adenylation_DNA_ligase_I_Euk 396..618 CDD:185710 90/223 (40%)
OBF_DNA_ligase_I 623..770 CDD:153438 58/150 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.