DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and K07C5.3

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_505659.1 Gene:K07C5.3 WormBaseID:WBGene00010626 Length:493 Species:Caenorhabditis elegans

Alignment Length:374 Identity:70/375 (19%)
Similarity:131/375 (35%) Gaps:106/375 (28%)


  Fly     1 MQKSITSFFKKKSDATDSPSPPKK----------VPKIDAKTELPDE-PHIKS-ESASPETKPKV 53
            |.|.:.:||....|.:..|...|:          :.|....|::.|| ..|:. |..:.|.:.::
 Worm    34 MGKIMPNFFVAAKDPSKPPPDMKQYFHTNCLFEMLFKARPTTKVIDETDEIEGFEDLNAEDQDEI 98

  Fly    54 EPMSVDSEEKTSPVKNVKKEPKEVD-DKTTDKKVTTIGLNSTAATK----EDVENYDPSADSYHP 113
            :.:..:..||.|  |:...|||:.. .|.|::|.....:.:|.:.|    |.:::..|:..:...
 Worm    99 KKLVDELAEKRS--KDGPAEPKKTPAKKKTEEKEEKGDVEATPSRKRKNEETLKSKRPTEFNEES 161

  Fly   114 LKNAYWKDKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVML---------------VSPE 163
            ..|:::|..||...|   :...|..|....:..:....||...:||               ::.|
 Worm   162 DFNSFYKFVKVCSVL---KEISVKSEKSAVITSLLQKKNFDGDLMLWLTFLIRESDQRSYNITDE 223

  Fly   164 DLVPSVYLSINQLAPAYEGLELGVAETTLMKAICKATGRNL----AHIKSQTQLTGDLGIVAEQS 224
            .|:            .|....|.:.|:.:.|.:.|:....|    ||.|..|...|         
 Worm   224 KLI------------QYFAKILDMGESKIQKYVTKSNDIALSISHAHEKKVTNEKG--------- 267

  Fly   225 RVSQRMMFQPAPLNVRDVFRKLREIAKLSGQSKMDLVYNMFVA--CRSSEARFFIRSLIGKLRIG 287
                       ..:::.:.|.|.:::|:.....: |.:..|.|  .|..|....||         
 Worm   268 -----------KWSLQKLDRYLEKLSKIEDDDAI-LSHLKFAAKRMRHDELDILIR--------- 311

  Fly   288 IAEQSLLTALAIGLVKKNHIDDCKAS--------KVPDVYKDEIVDTTL 328
                         |::|....|..||        |.|::::...:|:.:
 Worm   312 -------------LIRKELDTDADASIILKGVHPKAPEIFQSNGLDSVI 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 70/375 (19%)
DNA_ligase_A_N 126..292 CDD:282522 30/187 (16%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710
OBF_DNA_ligase_I 581..726 CDD:153438
K07C5.3NP_505659.1 zf-PARP 13..100 CDD:279039 14/66 (21%)
DNA_ligase_A_N 165..317 CDD:282522 35/210 (17%)
SDA1 <376..>445 CDD:283052
zf-CCHH 471..490 CDD:287283
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45674
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.