DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig-4

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_498653.2 Gene:lig-4 WormBaseID:WBGene00002986 Length:741 Species:Caenorhabditis elegans

Alignment Length:634 Identity:144/635 (23%)
Similarity:236/635 (37%) Gaps:170/635 (27%)


  Fly   119 WKDKKVTP--YLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYE 181
            ||:|...|  ...:.|.|....|   |.:..|.......|.|..:..| |.:.|:|         
 Worm    37 WKEKCSDPSDMFVIIRFFVSDYE---RFRKFDMGPTKLASFMAKTFHD-VRADYVS--------- 88

  Fly   182 GLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPA-PL---NVRDV 242
                     |:.|....|..:....|..:.:...|...|...|.:::.:.|..| |:   |.|| 
 Worm    89 ---------TISKDASTAARQLAEKISEEYRTENDESTVVTVSELNEILDFLAAGPMDDGNKRD- 143

  Fly   243 FRKLREIAKLSGQSKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIGLVKKNHI 307
              |:.::.|...:.:::.::|:.:.        .:.|.:|.....|.:....:|.||.    :..
 Worm   144 --KMSKLVKRCSEDELEWIFNVILK--------NVESALGAPSNRILDWISPSACAIW----DQT 194

  Fly   308 DDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPMLA 372
            .|.||     |.|.::|:.         :..|           ::.|..:....|......|||.
 Worm   195 HDLKA-----VLKGKLVEN---------KGTN-----------ELGETNDDDDEHLFKIWTPMLL 234

  Fly   373 QPTK--GVHEVFERFGGMQITCEWKYDGERAQIHRNEKG-EISIFSRNSENNTAKYPD------- 427
            |..|  ..:...|:|||.:...:.|:|||...:|:  || |...|:||:.:.:.:|.|       
 Worm   235 QKQKRGDWYANIEKFGGQKFFLQTKFDGENVLLHK--KGNEYRWFTRNNNDFSKEYGDSSMAIGK 297

  Fly   428 LIARSTALLKGDVKSYIIDSEIVAWDVERKQIL---------PFQVLSTRKRKNVDIEEIKVQVC 483
            |.:|..:....:.:|.|.:.|::.||.:.|::.         ..||||.|..|..|.:    |:.
 Worm   298 LSSRIHSFFNKECESAIFNCELMLWDKKTKKLCRHNDASTTSDAQVLSFRHVKPDDNQ----QLT 358

  Fly   484 VYIFDLLYINGTALVTKNLSERRKLL----LEHFQE--------VEGEWKFATALDTNDIDEVQQ 536
            |.:|||||:||.......|.:|.::|    |:..:|        .||..|          :::||
 Worm   359 VVLFDLLYLNGKPFFGAPLHQRLEMLKIAPLKKEREDTIFVAKHEEGSKK----------EDIQQ 413

  Fly   537 FLEESIKGNCEGLMVKTLDEEATYEIAKR--SRNWLKLK----KDYLSNVGDSLDLVVIGGYKGK 595
            |.|.::..|.||::||..|  :.|...:|  |..|.|||    ||.      .|||.::..:.|.
 Worm   414 FFEIAMANNEEGIVVKRTD--SVYVKGQRSASNGWFKLKPSASKDC------DLDLALVAVHPGA 470

  Fly   596 GRRTGTYGGFLLACYDTENEEYQSICKIGTGFTD--------------EDLQTHSEFLGKHVTSA 646
            ||...|.  :..|.:|.:.::|:.......|.:|              |:......|.||...:.
 Worm   471 GRNGKTL--YRFAAFDEKTQDYKLCLSCSYGLSDTVREAIRFEYGQLLEEAPEELTFYGKRPKNI 533

  Fly   647 AKSYYRY----------------------DPSLEP---DHWFEPVQVWE 670
            |:....|                      ||.:..   |...|.|..||
 Worm   534 ARGDGGYIDFERWQVIKITSNGVRNGKLVDPVMREWRLDKPVEQVNTWE 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 144/635 (23%)
DNA_ligase_A_N 126..292 CDD:282522 31/172 (18%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 74/255 (29%)
OBF_DNA_ligase_I 581..726 CDD:153438 25/130 (19%)
lig-4NP_498653.2 DNA_ligase_A_N 7..167 CDD:282522 31/163 (19%)
Adenylation_DNA_ligase_IV 218..451 CDD:185713 72/251 (29%)
NHEJ_ligase_lig 259..578 CDD:274295 86/345 (25%)
OBF_DNA_ligase_family 459..582 CDD:298752 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.