DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and Lig1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001076657.1 Gene:Lig1 MGIID:101789 Length:932 Species:Mus musculus

Alignment Length:760 Identity:380/761 (50%)
Similarity:511/761 (67%) Gaps:42/761 (6%)


  Fly    10 KKKSDATDSPSPPKKVPKIDAKTELPDEPHIKSESASPETKPKVEPMSVDSEEKTSPVKN----- 69
            :|:.|....||.|.|.|:....|:..:.|..|   |..:.||:.|      |:...|.:.     
Mouse   189 EKEGDQLIVPSEPTKSPESVTLTKTENIPVCK---AGVKLKPQEE------EQSKPPARGAKTLS 244

  Fly    70 ---------VKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWKDKKVT 125
                     ||.|.|:.:..|..|:.|...|        |..||:||.::|||:::|.||..:..
Mouse   245 SFFTPRKPAVKTEVKQEESGTLRKEETKGTL--------DPANYNPSKNNYHPIEDACWKHGQKV 301

  Fly   126 PYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAYEGLELGVAET 190
            |:||:||||:.|||...||||::||||...||:.:||.||:|.:|||:|:|.|..:||||||.:.
Mouse   302 PFLAVARTFEKIEEVSARLKMVETLSNLLRSVVALSPPDLLPVLYLSLNRLGPPQQGLELGVGDG 366

  Fly   191 TLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVRDVFRKLREIAKLSGQ 255
            .|:||:.:||||.|..|:::....||:|:|||.||.:||:|..|.||.:..||.|..:||:|:|.
Mouse   367 VLLKAVAQATGRQLESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTISGVFTKFCDIARLTGS 431

  Fly   256 S----KMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTAL--AIGLVKKNH-----IDD 309
            :    |||::..:|||||.||||:..|||.|:||:|:||||:|.||  |:.|.....     :.|
Mouse   432 ASMAKKMDIIKGLFVACRHSEARYIARSLSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPTAVVD 496

  Fly   310 CKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCPMHPGMPLRPMLAQP 374
            ....|..:..|..:.:..::||..:|:.|:.|.|||.:|::.::.|.|.|.:.||:||:||||.|
Mouse   497 AGKGKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGVPLKPMLAHP 561

  Fly   375 TKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTALLKGD 439
            |:||.||.:||..:..|||:||||:|||||..|.||:.|||||.|:||.||||:|:|...:....
Mouse   562 TRGVSEVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIISRIPKIKHPS 626

  Fly   440 VKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVTKNLSE 504
            |.|:|:|:|.||||.|:|||.|||||:|||||.||..||:||||:|.|||:|:||.:||.:.||.
Mouse   627 VTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVRQPLSR 691

  Fly   505 RRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGNCEGLMVKTLDEEATYEIAKRSRNW 569
            ||:||.|:|.|.|||:.|.|:|||.|.:::.:|||:|:|.:||||||||||.:|||||||||.||
Mouse   692 RRQLLRENFVETEGEFVFTTSLDTKDTEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNW 756

  Fly   570 LKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACYDTENEEYQSICKIGTGFTDEDLQT 634
            ||||||||..|||:|||||||.|.|:|:|.|.|||||||.||.|:||.|:|||:||||:||:|:.
Mouse   757 LKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEESEELQAICKLGTGFSDEELEE 821

  Fly   635 HSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRF 699
            |.:.|...|....:.|.|.|.::.||||.:|..||||||||||||||:.||.|:||.|:||||||
Mouse   822 HHQSLQALVLPTPRPYVRIDGAVAPDHWLDPSIVWEVKCADLSLSPIYPAARGLVDKEKGISLRF 886

  Fly   700 PRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQMEMED 744
            |||||:|.||..|.||.:||||.:|:.|.|::|.|.|....::||
Mouse   887 PRFIRVRKDKQPEQATTSNQVASLYRKQSQIQNQQSSDLDSDVED 931

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 380/761 (50%)
DNA_ligase_A_N 126..292 CDD:282522 89/170 (52%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 136/218 (62%)
OBF_DNA_ligase_I 581..726 CDD:153438 90/145 (62%)
Lig1NP_001076657.1 PLN03113 187..928 CDD:215584 378/756 (50%)
DNA_ligase_A_N 302..473 CDD:282522 90/171 (53%)
Adenylation_DNA_ligase_I_Euk 545..763 CDD:185710 136/218 (62%)
OBF_DNA_ligase_I 768..913 CDD:153438 90/145 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332588774
eggNOG 1 0.900 E1_COG1793
Hieranoid 1 1.000
Homologene 1 1.000 H197
Inparanoid 1 1.050 733 1.000 Inparanoid score I599
Isobase 1 0.950 0 Normalized mean entropy S1058
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003190
OrthoInspector 1 1.000 T1085451
orthoMCL 1 0.900 OOG5_127375
Panther 1 1.100 LDO PTHR45674
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2092
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.