DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and LOC101731611

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_004920869.2 Gene:LOC101731611 ID: Length:134 Species:Xenopus tropicalis

Alignment Length:137 Identity:86/138 (62%)
Similarity:103/138 (75%) Gaps:4/138 (3%)


  Fly   370 MLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSENNTAKYPDLIARSTA 434
            |||.||||:.||.:||.....|||:||||||||||..|.||:.|:|||.||||.||||:|:|...
 Frog     1 MLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHIYSRNQENNTTKYPDIISRIPK 65

  Fly   435 LLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKVQVCVYIFDLLYINGTALVT 499
            :.|..|||.|:|:|.||||.|:|||.|||||:|||||:||..|||||||||.||:||:||..   
 Frog    66 IKKESVKSCILDTEAVAWDPEKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDMLYLNGEV--- 127

  Fly   500 KNLSERR 506
             :|.|:|
 Frog   128 -SLLEKR 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 86/138 (62%)
DNA_ligase_A_N 126..292 CDD:282522
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 86/138 (62%)
OBF_DNA_ligase_I 581..726 CDD:153438
LOC101731611XP_004920869.2 Adenylation_DNA_ligase_I_Euk 1..>132 CDD:185710 85/135 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D182401at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.