DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAlig1 and lig1

Sequence 1:NP_611843.2 Gene:DNAlig1 FlyBaseID:FBgn0262619 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_002941929.1 Gene:lig1 XenbaseID:XB-GENE-1009779 Length:1040 Species:Xenopus tropicalis

Alignment Length:787 Identity:412/788 (52%)
Similarity:538/788 (68%) Gaps:57/788 (7%)


  Fly    10 KKKSDATDSPSPPKKVPK---------IDAKTELPDEPHIK--SESASPETKPKVEPMSVDSEEK 63
            |:....:.||:...|.||         :..|.:..|:...|  ||..|.|.|...||     |:|
 Frog   262 KELQPKSTSPNSKPKTPKAKSGKKHSPLQKKVKFSDKVSSKDDSEGKSSEEKSDEEP-----EKK 321

  Fly    64 TSPVKNVKK-----EPKEVDDKT-------TDKKVTTIGLNSTAATK---------------EDV 101
            ..|.|.||:     .||:...||       .:|..:...|.::...|               ||.
 Frog   322 ADPAKPVKQISSFFAPKKPAIKTEKKEEIMNEKNASETSLEASPKPKKTVSSFFGAIKPEPSEDQ 386

  Fly   102 ENYDPSADSYHPLKNAYWKDKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLV 166
            ..|:||..||||:.:|.|.:.:..||||:||||:.|||...|||.|:|||||..||:.::|.||:
 Frog   387 AVYNPSKSSYHPINDACWSNGQKVPYLAVARTFERIEEESARLKNIETLSNFLRSVIALTPGDLL 451

  Fly   167 PSVYLSINQLAPAYEGLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMM 231
            |.:||.:|:|.|||||||||:.||.||||:.:||||.|..|||:.|..||||:|||.||.:||.|
 Frog   452 PCIYLCLNRLGPAYEGLELGIGETILMKAVAQATGRQLEKIKSEAQEKGDLGLVAESSRSNQRTM 516

  Fly   232 FQPAPLNVRDVFRKLREIAKLSGQS----KMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQS 292
            |.|..|....||.||::||:::|.:    |:|::..:|||||.||||:..|||.||||||:||||
 Frog   517 FTPPKLMASGVFSKLKDIARMTGNASMNKKIDIIKGLFVACRHSEARYIARSLGGKLRIGLAEQS 581

  Fly   293 LLTAL--AIGLVKKNH-----IDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKY 350
            :|:|:  |:.|....|     :.|.......|..|..|.|..::||..:|:.||||.|||.:|::
 Frog   582 VLSAIAQAVCLTPPGHDAPPTVMDAGKGMSTDARKSWIEDKAMILKQTFCELPNYDAIIPILLEH 646

  Fly   351 DIKELQERCPMHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFS 415
            .|.:|.:.|.:.||:||:||||.||||:.||.:||.....|||:||||||||||..|.||:.|:|
 Frog   647 GIDDLPKHCRLTPGIPLKPMLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHIYS 711

  Fly   416 RNSENNTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKV 480
            ||.||||.||||:|:|...:.|..|||.|:|:|.||||.|:|||.|||||:|||||:||..||||
 Frog   712 RNQENNTTKYPDIISRIPKIKKESVKSCILDTEAVAWDPEKKQIQPFQVLTTRKRKDVDASEIKV 776

  Fly   481 QVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEESIKGN 545
            |||||.||:||:||.:||.:..::||:||.:.|.|.|||:.|||.:||::.||:.:||::|||.:
 Frog   777 QVCVYAFDMLYLNGESLVKEPFAKRRQLLRDSFLETEGEFMFATYMDTSNTDEISEFLDQSIKDS 841

  Fly   546 CEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTGTYGGFLLACY 610
            |||||||||:::|||||||||.||||||||||..|||:|||||||.|.|||:|||.|||||||.|
 Frog   842 CEGLMVKTLEQDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRTGIYGGFLLASY 906

  Fly   611 DTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPDHWFEPVQVWEVKCAD 675
            |.|:||||:|||||||||||||:.|..:|..||..:.:||||:|.:.||||||:|||||||||||
 Frog   907 DEESEEYQTICKIGTGFTDEDLEKHYNYLKDHVIDSPRSYYRWDSATEPDHWFDPVQVWEVKCAD 971

  Fly   676 LSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQVAHMYQSQDQVKNNQKSSTQM 740
            ||:||:|:||:|:|:.|:|||||||||:||||||..|.||::.|||.:|:.|.|::|   ::|..
 Frog   972 LSISPVHKAALGLVEDEKGISLRFPRFLRIRDDKKPEEATNSFQVADLYRKQQQIQN---TTTTE 1033

  Fly   741 EMEDEFY 747
            :.|::||
 Frog  1034 KGEEDFY 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAlig1NP_611843.2 PLN03113 1..745 CDD:215584 410/784 (52%)
DNA_ligase_A_N 126..292 CDD:282522 99/170 (58%)
Adenylation_DNA_ligase_I_Euk 358..576 CDD:185710 138/218 (63%)
OBF_DNA_ligase_I 581..726 CDD:153438 101/145 (70%)
lig1XP_002941929.1 PLN03113 268..1020 CDD:215584 403/757 (53%)
DNA_ligase_A_N 411..582 CDD:282522 100/171 (58%)
Adenylation_DNA_ligase_I_Euk 654..872 CDD:185710 138/218 (63%)
OBF_DNA_ligase_I 877..1022 CDD:153438 101/145 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332580872
eggNOG 1 0.900 E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H197
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D182401at33208
OrthoFinder 1 1.000 FOG0003190
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.