DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP1 and DCP1

DIOPT Version :8

Sequence 1:NP_001163282.1 Gene:DCP1 / 37790 FlyBaseID:FBgn0034921 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_014492.1 Gene:DCP1 / 854016 SGDID:S000005509 Length:231 Species:Saccharomyces cerevisiae

Alignment Length:218 Identity:34/219 (16%)
Similarity:67/219 (31%) Gaps:92/219 (42%)


  Fly     2 ADESITR-------MNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHR-- 57
            |:.|.|:       :|...|.:.||..|:::..:.|.:.|.::..::||.|.:.:|...||.|  
Yeast     8 AENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDV 72

  Fly    58 -----------------------------------------NAEPFHS----------------- 64
                                                     |...:.|                 
Yeast    73 SQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDI 137

  Fly    65 ----IFINNRLNTTSF------------------VEPITGSLE---LQSQPPFLLYRNERSRIRG 104
                :.|.||:|..:|                  .|.....||   ::.:...::.:|.:..:.|
Yeast   138 YNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYG 202

  Fly   105 FWFYNSEECDRISGLVNGLLKSK 127
            .|.:...:...|..|:..||:::
Yeast   203 IWIHTVSDRQNIYELIKYLLENE 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DCP1NP_001163282.1 Dcp1 4..124 CDD:197362 32/212 (15%)
mRNA_decap_C 328..362 CDD:293346
DCP1NP_014492.1 Dcp1 18..222 CDD:197362 30/202 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16290
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.