DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP1 and DCP1A

DIOPT Version :8

Sequence 1:NP_001163282.1 Gene:DCP1 / 37790 FlyBaseID:FBgn0034921 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_060873.4 Gene:DCP1A / 55802 HGNCID:18714 Length:582 Species:Homo sapiens

Alignment Length:415 Identity:121/416 (29%)
Similarity:180/416 (43%) Gaps:85/416 (20%)


  Fly     4 ESITR----MNLAAIKKIDPYAKEIVDSSSHVAFYTFNSSQNEWEKTDVEGAFFIYHRNAEPFHS 64
            |:::|    |:|||:|:.|||...|.|.:..||.|||....|:|||||:||..|:|.|:|.|:|.
Human     2 EALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHG 66

  Fly    65 IFINNRLNTTSFVEPITGSLELQSQPPFLLYRNERSRIRGFWFYNSEECDRISGLVNGLLKSKDQ 129
            ..|.||||..:.|||:...||.|...|||||||....|...|||:..:|.||:.|:..:::.:.:
Human    67 FTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETR 131

  Fly   130 GTNGQAQRHVSAPQQPKQDSS-QPASIFNMLTKAQKDY--------NAQVSGGQP--------KT 177
            .:. ||.|...:|.|....|. :|..|..||::|:.:|        |....|.||        .|
Human   132 RSQ-QAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGST 195

  Fly   178 PSAENVTAGNVLKFFESA-KQATAESLF----HRVQPLSVDQLEKQQRAATPGEDLLPPAGRDNH 237
            .:.|.:.:|:..|...|. |..|.|.||    .:.|| :|..|:.::....||:     |.:...
Human   196 ETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQP-AVVGLDSEEMERLPGD-----ASQKEP 254

  Fly   238 ESRLS-PFQKM--------------------QQLNIQLL--------SDLKIGKSYATAQSPTVA 273
            .|.|. ||:::                    .::...:|        |:.|...:|....||.::
Human   255 NSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLS 319

  Fly   274 PSSSALMANDDAGKCLRRLLAGDKPGPALMPPTMFDAPNNGNPEPQQPQQPQQ--PLLNSTQFVQ 336
            |:                 |..:.| .|.:||::   |.|..........|:|  ||||......
Human   320 PT-----------------LPAEAP-TAQVPPSL---PRNSTMMQAVKTTPRQRSPLLNQPVPEL 363

  Fly   337 AFTYLIQNDKEFANKLHKAYLNGCS 361
            :...||.|...|...|:.....|.|
Human   364 SHASLIANQSPFRAPLNVTNTAGTS 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DCP1NP_001163282.1 Dcp1 4..124 CDD:197362 57/124 (46%)
mRNA_decap_C 328..362 CDD:293346 10/35 (29%)
DCP1ANP_060873.4 Dcp1 6..126 CDD:197362 56/120 (47%)
Herpes_BLLF1 <268..532 CDD:330317 27/143 (19%)
mRNA_decap_C 539..581 CDD:318863
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2380874
eggNOG 1 0.900 E1_KOG2868
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4042
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1509316at2759
OrthoFinder 1 1.000 FOG0002075
OrthoInspector 1 1.000 T610290
orthoMCL 1 0.900 OOG5_130739
Panther 1 1.100 O PTHR16290
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R298
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.