DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHDP and Rhox13

DIOPT Version :9

Sequence 1:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_001077350.3 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:233 Identity:60/233 - (25%)
Similarity:92/233 - (39%) Gaps:82/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLNKANFDKDCLYTANSEFYNSGAN------------GGGLSVA-------NHINHYNLMIDSSY 50
            :..:.:||.:..:....|..|:|..            .|.::||       :|.:...:..|:.|
  Rat     1 MAQRVSFDHNYYFMECEEETNAGVQARAVASTSTMEASGAMAVAQAGAACRSHASRGTIGYDTVY 65

  Fly    51 KLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGD-DGLSLTD------ 108
                 |..::|...|||.      :...|         ||:.:...:..|| |.||.:|      
  Rat    66 -----EPNVKGDPKQESE------SDTEE---------SYDDEDDDEDEGDEDDLSTSDQDTSDP 110

  Fly   109 -----------------------------KSKQRRIRT-------TFTSNQLNELEKIFLETHYP 137
                                         :|::||.|.       .||..|:.|:|.:|.||.||
  Rat   111 EQEEAALFVAAAAPPIAPAAAAIQIPGPHRSRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYP 175

  Fly   138 DIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAI 175
            |:.||.|:|..|::.|.:|:|||.|||||.||.||.|:
  Rat   176 DVLTRGELARTLNVPEVKVKVWFSNRRAKQRKNERRAM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 27/58 (47%)
Rhox13XP_001077350.3 Homeobox 157..206 CDD:278475 26/48 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.