DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHDP and Rhox13

Sequence 1:NP_523834.1 Gene:PHDP FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_001077350.3 Gene:Rhox13 RGDID:1586264 Length:234 Species:Rattus norvegicus

Alignment Length:233 Identity:60/234 (26%)
Similarity:92/234 (39%) Gaps:82/234 (35%)


  Fly     5 LLNKANFDKDCLYTANSEFYNSGAN------------GGGLSVA-------NHINHYNLMIDSSY 50
            :..:.:||.:..:....|..|:|..            .|.::||       :|.:...:..|:.|
  Rat     1 MAQRVSFDHNYYFMECEEETNAGVQARAVASTSTMEASGAMAVAQAGAACRSHASRGTIGYDTVY 65

  Fly    51 KLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHLKSYGD-DGLSLTD------ 108
                 |..::|...|||.      :...|         ||:.:...:..|| |.||.:|      
  Rat    66 -----EPNVKGDPKQESE------SDTEE---------SYDDEDDDEDEGDEDDLSTSDQDTSDP 110

  Fly   109 -----------------------------KSKQRRIRT-------TFTSNQLNELEKIFLETHYP 137
                                         :|::||.|.       .||..|:.|:|.:|.||.||
  Rat   111 EQEEAALFVAAAAPPIAPAAAAIQIPGPHRSRRRRHRRHRRSSPYLFTQWQVEEMENLFEETPYP 175

  Fly   138 DIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAI 175
            |:.||.|:|..|::.|.:|:|||.|||||.||.||.|:
  Rat   176 DVLTRGELARTLNVPEVKVKVWFSNRRAKQRKNERRAM 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 27/59 (46%)
Rhox13XP_001077350.3 Homeobox 157..206 CDD:278475 26/49 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24329
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.