DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHDP and Rhox10

Sequence 1:NP_523834.1 Gene:PHDP FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001032670.1 Gene:Rhox10 RGDID:1563291 Length:201 Species:Rattus norvegicus

Alignment Length:168 Identity:48/169 (28%)
Similarity:76/169 (45%) Gaps:45/169 (27%)


  Fly    44 LMIDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIGSYNTDFHL-----KSYGDDG 103
            :|.||..::.|  :|:|....:...:|              |.:|.   |.||     ::|..:.
  Rat    22 IMTDSQQRVAA--AAVRCRFGRGVRVL--------------HELGQ---DEHLSFKYKQNYSYET 67

  Fly   104 LSLTD---------------KSKQRRIR-TTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLT 152
            ...|.               :|..|:|: ..||..||.||||.|.||.|||.:.|:.:|:.:|:.
  Rat    68 RKETQARPSEPEKAAGTAACRSNNRQIKHHKFTYAQLCELEKAFQETQYPDAHRRKALAALIHVD 132

  Fly   153 EARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKN 190
            |.:|:.||:|:|||:||:.:..:.     ||...|..|
  Rat   133 ECKVKAWFKNKRAKYRKKHKELLL-----SSATSGTLN 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 25/53 (47%)
Rhox10NP_001032670.1 Homeobox 99..148 CDD:278475 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24329
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.