DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHDP and Vsx2

Sequence 1:NP_523834.1 Gene:PHDP FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_017449515.1 Gene:Vsx2 RGDID:621215 Length:380 Species:Rattus norvegicus

Alignment Length:105 Identity:52/106 (49%)
Similarity:63/106 (59%) Gaps:22/106 (21%)


  Fly   104 LSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFR 168
            |:.|.|.|:||.||.|||.||.||||.|.|.||||:|.||.:|.|..|.|.|:||||||||||:|
  Rat   140 LNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWR 204

  Fly   169 KQE-------------------RHAIYIMKD--KSSKLDG 187
            |:|                   ||:|.:.:.  ||:| ||
  Rat   205 KREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAK-DG 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 35/52 (67%)
Vsx2XP_017449515.1 Homeobox 153..204 CDD:278475 34/51 (67%)
OAR 319..336 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.