DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PHDP and ARX

Sequence 1:NP_523834.1 Gene:PHDP FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX HGNCID:18060 Length:562 Species:Homo sapiens

Alignment Length:82 Identity:50/83 (60%)
Similarity:62/83 (75%) Gaps:9/83 (11%)


  Fly   100 GDDGLSLTD---------KSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEAR 155
            |:|.:.|:.         |.||||.||||||.||.|||:.|.:|||||::||||:|.:|.|||||
Human   307 GEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEAR 371

  Fly   156 VQVWFQNRRAKFRKQER 172
            |||||||||||:||:|:
Human   372 VQVWFQNRRAKWRKREK 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 39/52 (75%)
ARXNP_620689.1 GCG-encoded polyalanine repeat 102..111
Homeobox 332..384 CDD:306543 39/52 (75%)
OAR 526..544 CDD:309087
OAR. {ECO:0000255|PROSITE-ProRule:PRU00138} 530..543
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24329
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.