DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4882 and mrps27

Sequence 1:NP_001286791.1 Gene:CG4882 FlyBaseID:FBgn0025336 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001003778.1 Gene:mrps27 ZFINID:ZDB-GENE-040808-39 Length:398 Species:Danio rerio

Alignment Length:328 Identity:60/329 (18%)
Similarity:117/329 (36%) Gaps:118/329 (36%)


  Fly    84 VKQLLDSTNPQETISVLRNPIQYGLFVDQFSGCFLLDFLLHNGHAVESAQLATILVDRNL---CN 145
            ::|.|......:.:..|:|.:|:|:|.|.|:...|:|               :.:.|::.   |:
Zfish   114 IRQCLKYGARDKALYTLKNKVQFGIFPDDFTFNILID---------------SFIKDKDFKGACS 163

  Fly   146 NELLESLALQSFWSFAKEFKPFESSQVQPPAKNVEVEKVRVKFIRNYPDDASENTEEKKLGRAMV 210
              ::|.:.||         :.||....|     :.......|::...|:.:.:  ||..:|.:::
Zfish   164 --VVEEVMLQ---------ESFEQISTQ-----ILSLHALSKYLATQPELSWQ--EEGSIGASLL 210

  Fly   211 RLGSGEGSLKELKQ------NVALLGYVLTGQV-------------------------------- 237
            ..|        |||      :..|:|..|.|:|                                
Zfish   211 LAG--------LKQENSIGFSARLMGLALIGKVEFSRGIHAVFHEMPLIWSSGYLRRAVAVLQAV 267

  Fly   238 ----------PEASSFL---------------ASNSAALHKETLLAAQSIVESLKLEGSEELLKS 277
                      .:|.:|:               ..|.:.:|    |..:..:|.|||.......:.
Zfish   268 SSDFTGVQISEDALNFMEKILQDLSAISDGANTQNDSEMH----LDEEDQLERLKLPQYISSFRE 328

  Fly   278 LQEAVEKSSK--SNAIQSLLENSVKANVQKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSVEE 340
            |:|.::...|  |.:::||||     .:...|...|:.|.:..|:|..:.:..:||:.:|:...:
Zfish   329 LKERLQTQDKIVSRSLESLLE-----LLPISEESDLSAYRQRMQDWGDEQQKLIQREAESREKSK 388

  Fly   341 RKA 343
            |.|
Zfish   389 RDA 391

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4882NP_001286791.1 MRP-S27 1..350 CDD:287055 60/329 (18%)
mrps27NP_001003778.1 MRP-S27 1..398 CDD:287055 60/329 (18%)
PPR repeat 109..136 CDD:276811 5/22 (23%)
PPR_1 137..167 CDD:289614 9/47 (19%)
PPR repeat 142..172 CDD:276811 8/56 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173846626
eggNOG 1 0.900 E1_KOG4570
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D344346at33208
OrthoFinder 1 1.000 FOG0006366
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.