| Sequence 1: | NP_001286791.1 | Gene: | CG4882 / 37787 | FlyBaseID: | FBgn0025336 | Length: | 406 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001003778.1 | Gene: | mrps27 / 445321 | ZFINID: | ZDB-GENE-040808-39 | Length: | 398 | Species: | Danio rerio |
| Alignment Length: | 328 | Identity: | 60/328 - (18%) |
|---|---|---|---|
| Similarity: | 117/328 - (35%) | Gaps: | 118/328 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 VKQLLDSTNPQETISVLRNPIQYGLFVDQFSGCFLLDFLLHNGHAVESAQLATILVDRNL---CN 145
Fly 146 NELLESLALQSFWSFAKEFKPFESSQVQPPAKNVEVEKVRVKFIRNYPDDASENTEEKKLGRAMV 210
Fly 211 RLGSGEGSLKELKQ------NVALLGYVLTGQV-------------------------------- 237
Fly 238 ----------PEASSFL---------------ASNSAALHKETLLAAQSIVESLKLEGSEELLKS 277
Fly 278 LQEAVEKSSK--SNAIQSLLENSVKANVQKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSVEE 340
Fly 341 RKA 343 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4882 | NP_001286791.1 | MRP-S27 | 1..350 | CDD:287055 | 60/328 (18%) |
| mrps27 | NP_001003778.1 | MRP-S27 | 1..398 | CDD:287055 | 60/328 (18%) |
| PPR repeat | 109..136 | CDD:276811 | 4/21 (19%) | ||
| PPR_1 | 137..167 | CDD:289614 | 8/46 (17%) | ||
| PPR repeat | 142..172 | CDD:276811 | 8/55 (15%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170580223 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4570 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D344346at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0007077 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR21393 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3141 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 8 | 7.930 | |||||