DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4882 and MRPS27

DIOPT Version :9

Sequence 1:NP_001286791.1 Gene:CG4882 / 37787 FlyBaseID:FBgn0025336 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001273677.1 Gene:MRPS27 / 23107 HGNCID:14512 Length:428 Species:Homo sapiens


Alignment Length:309 Identity:64/309 - (20%)
Similarity:122/309 - (39%) Gaps:58/309 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VKQLLDSTNPQETISVLRNPIQYGLFVDQFSGCFLLD-----------------FLLHNGHAVES 131
            ::|.|......:.:..|.|.:|||:|.|.|:...|:|                 .::.....|.|
Human   127 IRQCLKYDAQDKALYTLVNKVQYGIFPDNFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPS 191

  Fly   132 AQLATILVDRNLCNNELLESLALQSFWSFAKEFKPFESSQVQPPAK------------------N 178
            .||.::.|        |...||.::.:|:.:| :.|.:|.:.|..|                  .
Human   192 TQLLSLYV--------LFHCLAKKTDFSWEEE-RNFGASLLLPGLKQKNSVGFSSQLYGYALLGK 247

  Fly   179 VEVEKVRVKFIRNYPDDASENTEEKKLGRAMVRLGSGEGSLKELKQNVALLGYVLTGQVPEASSF 243
            ||:::.......|.|........::.| :.|.::.:....:|..::.:.:||.||...   .|:.
Human   248 VELQQGLRAVYHNMPLIWKPGYLDRAL-QVMEKVAASPEDIKLCREALDVLGAVLKAL---TSAD 308

  Fly   244 LASNSAALHKETLLAAQSIVESLKLEGSE--------ELLKSLQEAVEKSSK--SNAIQSLLENS 298
            .||...:.:.|....::.:||.|.:|.:|        |..|:|...::...|  |..:.||....
Human   309 GASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQL 373

  Fly   299 VKANVQKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSVEERKATIQK 347
            ||..:...|.:.:|.|.::.|:|.......:||:...:...:::...||
Human   374 VKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQK 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4882NP_001286791.1 MRP-S27 1..350 CDD:287055 64/309 (21%)
MRPS27NP_001273677.1 MRP-S27 1..418 CDD:287055 62/303 (20%)
PPR repeat 122..149 CDD:276811 4/21 (19%)
PPR repeat 155..185 CDD:276811 3/29 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146779
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4570
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D344346at33208
OrthoFinder 1 1.000 - - FOG0007077
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21393
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3141
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.