DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4882 and Mrps27

Sequence 1:NP_001286791.1 Gene:CG4882 FlyBaseID:FBgn0025336 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006517665.1 Gene:Mrps27 MGIID:1919064 Length:456 Species:Mus musculus

Alignment Length:310 Identity:68/311 (22%)
Similarity:117/311 (38%) Gaps:90/311 (29%)


  Fly   104 IQYGLFVDQFSGCFLLDFLLHNGH-----------------AVESAQLATILVDRNLCNNELLES 151
            :|||:|.|.|:...|:|:.:..|:                 .|.|.|..::.|        |...
Mouse   174 VQYGIFPDNFTFNLLMDYFIKKGNYKDALSVVFEIMMQEAFDVPSTQFLSLYV--------LYRC 230

  Fly   152 LALQSFWSFAKEFKPFESSQVQPPAK------------------NVEVEK-VR-------VKFIR 190
            ||.::..::.:| :.|.:|.:....|                  .||::: ||       :.:..
Mouse   231 LAEKTELTWEEE-RDFGASLLLSGLKQRNTVGLSSQLYGYALLGKVELQRGVRAVYHGMPLMWTP 294

  Fly   191 NYPDDA-------SENTEEKKLGRAMVRLGSGEGSLKELKQNVALLGYVLTGQVPEASSFLASNS 248
            .|.|.|       :.:.|:.||||.:  |...:|.||           |:|.  |:..:   |.:
Mouse   295 GYLDRALQVMERVASSPEDLKLGREV--LDVLDGVLK-----------VVTS--PDVQT---SEA 341

  Fly   249 AALHKETLLAAQSIVESLKLEGSEE-----LLKSLQEAVEKSSKSNAIQS-----LLENSVKANV 303
            .....|..|.:.::||.|..|..|:     .|:..|.:..|..:.|.::|     |....||..:
Mouse   342 QPQEGEDGLGSANLVEQLDTEEPEQSKLPRYLERFQASRSKLQELNRVESESLLTLTTQLVKEKL 406

  Fly   304 QKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSVEERKATIQKTLSELE 353
            ...|.:.||.|.:..:||..:....:||:   |...|:.....:.||..|
Mouse   407 PACEAEDLATYEQKLREWHLERVQLIQRE---QEQREKAKQEYQALSAAE 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4882NP_001286791.1 MRP-S27 1..350 CDD:287055 66/306 (22%)
Mrps27XP_006517665.1 MRP-S27 1..453 CDD:287055 67/309 (22%)
PPR repeat 182..212 CDD:276811 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173847690
eggNOG 1 0.900 E1_KOG4570
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006366
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21393
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3141
TreeFam 1 0.960
76.920

Return to query results.
Submit another query.