DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4882 and mrps-27

Sequence 1:NP_001286791.1 Gene:CG4882 FlyBaseID:FBgn0025336 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_493580.1 Gene:mrps-27 WormBaseID:WBGene00010766 Length:424 Species:Caenorhabditis elegans

Alignment Length:376 Identity:93/377 (25%)
Similarity:168/377 (45%) Gaps:47/377 (12%)


  Fly    33 KFAAGSSHAVTSVDLDVFV-NPDNRPMDLVDRLLKLRKQKEASLVPLIPSVLVKQLLDSTNPQET 96
            ||..|...:...||..|.| ...::..|:::.|.|||...:|:.........:.:||....|:..
 Worm    60 KFIGGGYASAVDVDAAVCVAEQKDQVDDVIELLYKLRHSVKAAEKLESSEYAIVRLLLKYQPETI 124

  Fly    97 ISVLRNPIQYGLFVDQFSGCFLLDFLLHNGHAVESAQLATILVDRNLCNNELLESLALQSFWSFA 161
            |::..:||.||:|::|...|.::|..|...:...:|::.|.::.:...:||||..|.|   :..|
 Worm   125 ITLANDPINYGVFLNQHLACIVIDHFLKTSNIQAAARIVTWMIQQEELDNELLNILGL---YVCA 186

  Fly   162 KEFK-PFESSQVQPPAKNVEVEKVRVKFIRNYP------DDASENTE----EKKLGRAMVRLGSG 215
            |..: |.|...:.....:.|.|.:....||.:.      |...|:.:    ...:|:::..|...
 Worm   187 KWVELPVEQQTLDLGGADDEEEDINDDDIRTFKFPYLKNDSFDEHFDLSNPHHLIGKSLQWLSRD 251

  Fly   216 EGSL-KELKQNVALLGYVLTGQVPEASSFLASNSAALHKETLLAAQSIVESLKLEGSEE------ 273
            ...: .:||.::..||.||..::.||:|.:::        .:...:|||.. ||.|.||      
 Worm   252 TKFIDSQLKSSLNALGAVLFEKLAEANSTIST--------AIPCVKSIVAG-KLAGKEEEAGVKN 307

  Fly   274 LLKSLQEAVEKSSKSNAIQSLLENSVKANVQKFEPKLLADYGESYQEWAKKFEAAVQRQLDSQSV 338
            :|:|:.|..|...|.:.|  :||:..|..|.: |..|.|...:.:.||.::.:|..:.|.....:
 Worm   308 ILESIGEVEEAKEKLSDI--ILEHLKKIQVSE-EDSLCAVQTKLFGEWNERRQALAKSQAQKVLL 369

  Fly   339 EERKATIQKTLSELEAKRQNLWFFENR-------------DDIDIQIYKKK 376
            ..|:..|:..|.:|:.:.:.:.||:||             |:...|.:|||
 Worm   370 RLRQDEIRGELKQLDEQEEQMSFFKNRLIWEKRAAENTQIDEESKQRHKKK 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4882NP_001286791.1 MRP-S27 1..350 CDD:287055 83/336 (25%)
mrps-27NP_493580.1 MRP-S27 1..381 CDD:287055 83/336 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173840917
eggNOG 1 0.900 E1_KOG4570
Hieranoid 1 1.000
Homologene 1 1.000 H50578
Inparanoid 1 1.050 82 1.000 Inparanoid score I3732
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D344346at33208
OrthoFinder 1 1.000 FOG0006366
OrthoInspector 1 1.000 T475037
orthoMCL 1 0.900 OOG5_141181
Panther 1 1.100 LDO PTHR21393
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3141
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.