DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4882 and mrps27

Sequence 1:NP_001286791.1 Gene:CG4882 FlyBaseID:FBgn0025336 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002934866.1 Gene:mrps27 XenbaseID:XB-GENE-943403 Length:410 Species:Xenopus tropicalis

Alignment Length:351 Identity:71/352 (20%)
Similarity:140/352 (40%) Gaps:104/352 (30%)


  Fly    84 VKQLLDSTNPQETISVLRNPIQYGLFVDQFSGCFLLDFLLHNGHAVESAQLAT-ILVDRNL--CN 145
            ::|.|....|::.:..|:|.:|||:|.|.|:...|||..:.|.:..::..:.| |::..:.  .:
 Frog   114 IRQCLKYGAPEKALYTLQNKVQYGIFPDDFTFNLLLDTFIKNENYQDAVSVVTEIMLQESFEKVS 178

  Fly   146 NELLESLALQSFWSFAKEFKPFESSQVQPPAKNVEVEKVRVKFIRNYPDDASENTEEKKLGRAMV 210
            .:||...||.                               :::...||  .:..:|:.:|.:::
 Frog   179 TQLLSLYALH-------------------------------RYLSGKPD--LKWDQERNIGASLL 210

  Fly   211 RLGSGEGSLKELKQ------NVALLGYVLTGQVPEASSFLASNSAALHKETLL--------AAQS 261
            ..|        |||      :..|.||.|.|:|.     :.:...|::.:..|        .|.:
 Frog   211 LAG--------LKQENTVGYSSQLYGYSLLGKVE-----VCNGLRAVYNQMPLIWTPGYYSRALN 262

  Fly   262 IVESLKLEGSEELLKSLQEAVE--KSSKSNAIQSLLENSVKA---------NVQKFEPKLLADYG 315
            ::|  |:....|.:|..:|:::  |.|...||...||...||         :.:|.|..:|.:|.
 Frog   263 VME--KVSALPEDIKICKESIDILKESLDFAIAQHLEKKSKASGEEPMEPEDPEKTEADVLPEYL 325

  Fly   316 ESYQEWAKKFEAAVQRQLDS-QSVEERKATIQKTLSELEAKRQNLWFFENRDDIDIQIYKKKVYY 379
            ..:||.:.|.::..:...|. |::..:  .:|:.|.:.|..             |::.|:|::  
 Frog   326 HRFQELSAKLDSLSKIATDGLQNLTTK--LVQEILPDCEKS-------------DVERYEKQL-- 373

  Fly   380 PKRW---------FGKKKKPKAADTF 396
             :.|         ..|:.:.||.:.|
 Frog   374 -REWQEERVQLTAREKEMREKAKEEF 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4882NP_001286791.1 MRP-S27 1..350 CDD:287055 62/295 (21%)
mrps27XP_002934866.1 MRP-S27 1..404 CDD:287055 71/352 (20%)
PPR repeat 102..136 CDD:276811 6/22 (27%)
PPR repeat 142..169 CDD:276811 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D344346at33208
OrthoFinder 1 1.000 FOG0006366
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.