DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF6 and eIF6B

Sequence 1:NP_659573.1 Gene:eIF6 FlyBaseID:FBgn0034915 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_181512.1 Gene:eIF6B AraportID:AT2G39820 Length:247 Species:Arabidopsis thaliana

Alignment Length:244 Identity:144/245 (59%)
Similarity:195/245 (80%) Gaps:2/245 (1%)


  Fly     1 MALRVQFENND-DIGVFTKLTNTYCLV-AIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLT 63
            ||.|:|::||: :||||:||||.|||| |...|..|::.:|::|...||:|..::||...||.|.
plant     1 MATRLQYDNNNCEIGVFSKLTNAYCLVSATSASANFFTGYESKLKGVIPIVTTSIGGSGTIGSLC 65

  Fly    64 VGNRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPDLDKETEEI 128
            |||:||||:.::.||:||||||:||||.|.:.|:||.:.||||.||||||||||||.|:|:||||
plant    66 VGNKNGLLLSHTITDQELQHLRDSLPDEVVVQRIEEPICALGNAIACNDYVALVHPKLEKDTEEI 130

  Fly   129 IADVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVL 193
            |:|||.|||:|||||:|.|||||..|||.|||||..|::::..||::|:|||||||||||||:|:
plant   131 ISDVLGVEVYRQTIANNELVGSYCSLSNNGGMVHSNTNVEEMVELANLVQVPLVAGTVNRGSQVI 195

  Fly   194 AAGMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIE 242
            :||:.||||.:|.|.:|||.|:||:.::|||.|:||..|.:::|.:||:
plant   196 SAGLTVNDWTAFCGSDTTAVELSVVNNIFKLVQSQPDFVGSEMRKSLID 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF6NP_659573.1 PTZ00136 1..245 CDD:185471 144/245 (59%)
eIF6BNP_181512.1 IF6 1..246 CDD:294171 144/245 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1157302at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127488
Panther 1 1.100 O PTHR10784
Phylome 1 0.910 0.667 Consistency score
43.920

Return to query results.
Submit another query.