DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF6 and EIF6

Sequence 1:NP_659573.1 Gene:eIF6 FlyBaseID:FBgn0034915 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001254739.1 Gene:EIF6 HGNCID:6159 Length:245 Species:Homo sapiens

Alignment Length:245 Identity:190/246 (77%)
Similarity:220/246 (89%) Gaps:0/246 (0%)


  Fly     1 MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVG 65
            ||:|..||||.:||.|.|||||||||||||||.|||.||.||.||||||||::.|||||||:.||
Human     1 MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVG 65

  Fly    66 NRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPDLDKETEEIIA 130
            ||:||||||:|||:||||:||||||.|:|.||||||||||||..|||||||||||||:|||||:|
Human    66 NRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILA 130

  Fly   131 DVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAA 195
            |||||||||||:||..|||||.|.|||||:|||||||:||||||||||||||||||||||||:||
Human   131 DVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAA 195

  Fly   196 GMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIEDMS 245
            |||||||.:|.|::||:||:||:|||||||:|||:|:.|.:|.:||:.::
Human   196 GMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF6NP_659573.1 PTZ00136 1..245 CDD:185471 190/244 (78%)
EIF6NP_001254739.1 PTZ00136 1..244 CDD:185471 190/243 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238917083
eggNOG 1 0.900 E1_COG1976
Hieranoid 1 1.000
Homologene 1 1.000 H7135
Inparanoid 1 1.050 394 1.000 Inparanoid score I1955
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1157302at2759
OrthoFinder 1 1.000 FOG0004010
OrthoInspector 1 1.000 T1072725
orthoMCL 1 0.900 OOG5_127488
Panther 1 1.100 LDO PTHR10784
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R598
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.