DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF6 and Eif6

Sequence 1:NP_659573.1 Gene:eIF6 FlyBaseID:FBgn0034915 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001032429.1 Gene:Eif6 RGDID:1305373 Length:245 Species:Rattus norvegicus

Alignment Length:245 Identity:188/246 (76%)
Similarity:221/246 (90%) Gaps:0/246 (0%)


  Fly     1 MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVG 65
            ||:|..||||.::|.|.|||||||||||||||.|||.||.||.||||||||::.|||||||:.||
  Rat     1 MAVRASFENNCEVGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVG 65

  Fly    66 NRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPDLDKETEEIIA 130
            ||:||||||:|||:||||:||||||:|:|.||||||||||||..|||||||||||||:|||||:|
  Rat    66 NRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILA 130

  Fly   131 DVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAA 195
            |||||||||||:||..|||||.|.|||||:|||||||:||||||||||||||||||||||||:||
  Rat   131 DVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAA 195

  Fly   196 GMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIEDMS 245
            |||||||.:|.|::||:||:||:|||||||:|:|:|:.|.:|.:||:.::
  Rat   196 GMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTIATSMRDSLIDSLT 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF6NP_659573.1 PTZ00136 1..245 CDD:185471 188/244 (77%)
Eif6NP_001032429.1 PTZ00136 1..244 CDD:185471 188/243 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238920854
eggNOG 1 0.900 E1_COG1976
Hieranoid 1 1.000
Homologene 1 1.000 H7135
Inparanoid 1 1.050 393 1.000 Inparanoid score I1884
OMA 1 1.010
OrthoDB 1 1.010 D1157302at2759
OrthoFinder 1 1.000 FOG0004010
OrthoInspector 1 1.000 T1086384
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10784
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.