DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: eIF6 and tif6

Sequence 1:NP_659573.1 Gene:eIF6 FlyBaseID:FBgn0034915 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_588491.1 Gene:tif6 PomBaseID:SPCC1919.09 Length:244 Species:Schizosaccharomyces pombe

Alignment Length:242 Identity:176/243 (72%)
Similarity:209/243 (86%) Gaps:1/243 (0%)


  Fly     1 MALRVQFENNDDIGVFTKLTNTYCLVAIGGSETFYSAFEAELGDTIPVVHANVGGCRIIGRLTVG 65
            ||||.||||:::||||:.|||:|.|||:||||.|||.|||||||.:||||..:||.|||||||.|
pombe     1 MALRAQFENSNEIGVFSNLTNSYALVALGGSENFYSVFEAELGDVVPVVHTTIGGTRIIGRLTCG 65

  Fly    66 NRNGLLVPNSTTDEELQHLRNSLPDAVKIYRVEERLSALGNVIACNDYVALVHPDLDKETEEIIA 130
            ||.|||||:||||.|||||||||||.|||.||:||||||||::||||||||||||:::|||||||
pombe    66 NRKGLLVPSSTTDNELQHLRNSLPDPVKIQRVDERLSALGNIVACNDYVALVHPDIERETEEIIA 130

  Fly   131 DVLKVEVFRQTIADNSLVGSYAVLSNQGGMVHPKTSIQDQDELSSLLQVPLVAGTVNRGSEVLAA 195
            |||.|||||||:|.|.|.|||..|||||.:|||:||||:||||||||||||||||:||||:|:.|
pombe   131 DVLDVEVFRQTVAGNVLTGSYCALSNQGALVHPRTSIQEQDELSSLLQVPLVAGTINRGSDVIGA 195

  Fly   196 GMVVNDWLSFVGMNTTATEISVIESVFKLNQAQPATVTTKLRAALIE 242
            |:|||||.:|.|::|||||::|.||:|||..|||:.:.:. |..|:|
pombe   196 GLVVNDWCAFAGLDTTATELAVCESIFKLQDAQPSAIISN-RDTLVE 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
eIF6NP_659573.1 PTZ00136 1..245 CDD:185471 176/243 (72%)
tif6NP_588491.1 PTZ00136 1..243 CDD:185471 176/243 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H7135
Inparanoid 1 1.050 364 1.000 Inparanoid score I444
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004010
OrthoInspector 1 1.000 T1124541
orthoMCL 1 0.900 OOG5_127488
Panther 1 1.100 LDO PTHR10784
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R598
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.