DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and MTR2

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_012735.1 Gene:MTR2 / 853649 SGDID:S000001669 Length:184 Species:Saccharomyces cerevisiae


Alignment Length:73 Identity:16/73 - (21%)
Similarity:32/73 - (43%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARTADTFTRLYYASVD----NRRQQIGRLY-LDNATLSWNGNG-AIGRQMIESYFQELPSSNHQL 71
            |:...|||:...|.:|    |:..|..:|: .:|..:.:|... |.....::.:..::..:.|.|
Yeast    16 AQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHAL 80

  Fly    72 NTLDAQPI 79
            ..:|...|
Yeast    81 TGVDYHAI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 16/73 (22%)
MTR2NP_012735.1 Mtr2 13..184 CDD:402175 16/73 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12612
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.