powered by:
Protein Alignment Nxt1 and MTR2
DIOPT Version :9
Sequence 1: | NP_611833.1 |
Gene: | Nxt1 / 37769 |
FlyBaseID: | FBgn0028411 |
Length: | 133 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012735.1 |
Gene: | MTR2 / 853649 |
SGDID: | S000001669 |
Length: | 184 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 73 |
Identity: | 16/73 - (21%) |
Similarity: | 32/73 - (43%) |
Gaps: | 6/73 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 ARTADTFTRLYYASVD----NRRQQIGRLY-LDNATLSWNGNG-AIGRQMIESYFQELPSSNHQL 71
|:...|||:...|.:| |:..|..:|: .:|..:.:|... |.....::.:..::..:.|.|
Yeast 16 AQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFAQATVFLQMWQNQVVQTQHAL 80
Fly 72 NTLDAQPI 79
..:|...|
Yeast 81 TGVDYHAI 88
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nxt1 | NP_611833.1 |
NTF2 |
11..132 |
CDD:238403 |
16/73 (22%) |
MTR2 | NP_012735.1 |
Mtr2 |
13..184 |
CDD:402175 |
16/73 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12612 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.