DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nxt1 and NTF2A

Sequence 1:NP_611833.1 Gene:Nxt1 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_174051.1 Gene:NTF2A AraportID:AT1G27310 Length:122 Species:Arabidopsis thaliana

Alignment Length:133 Identity:36/134 (27%)
Similarity:57/134 (43%) Gaps:17/134 (13%)


  Fly     1 MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELP 65
            ||.|..||         .|...||::.|..|..:..||.:.:.|::.|....|.|.|.:....||
plant     1 MDPDAVAK---------AFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTGLP 56

  Fly    66 --SSNHQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFA-DQQLRKFQQTFIVTAENDKWKVVSDC 127
              ...|.:.|:|.||.....     ..|:..||:::.| :|...||.|.|.:.:....:.|.:|.
plant    57 FQQCKHNITTVDCQPSGPAG-----GMLVFVSGNLQLAGEQHALKFSQMFHLISNQGNYYVFNDI 116

  Fly   128 YRM 130
            :|:
plant   117 FRL 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 31/124 (25%)
NTF2ANP_174051.1 NTF2 2..121 CDD:238403 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12612
Phylome 1 0.910 0.611 Consistency score
22.010

Return to query results.
Submit another query.