DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and NTL

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001323167.1 Gene:NTL / 837700 AraportID:AT1G11570 Length:153 Species:Arabidopsis thaliana


Alignment Length:125 Identity:34/125 - (27%)
Similarity:58/125 - (46%) Gaps:18/125 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELP--SSNHQLNTLDAQP 78
            |..|...||...||.|..:..||...:.|::.|....|...|.:..::||  ..:|.::|:|:||
plant    34 ASAFVNHYYHLFDNDRSSLSSLYNPTSLLTFEGQTIYGVDNISNKLKQLPFDQCHHLISTVDSQP 98

  Fly    79 IVDQAVSNQLA-----YLIMASGSVKF--ADQQLRKFQQTF-IVTAENDKWKVVSDCYRM 130
                   :.:|     .|:..|||::.  .|..|| |.||| ::......:.|.::.:|:
plant    99 -------SSMAGGCGGILVFVSGSIQLHGEDHPLR-FSQTFHLIPVLQGSFFVQNEMFRL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 34/125 (27%)
NTLNP_001323167.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.