DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nxt1 and nxt2

Sequence 1:NP_611833.1 Gene:Nxt1 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001299841.1 Gene:nxt2 ZFINID:ZDB-GENE-050521-1 Length:143 Species:Danio rerio

Alignment Length:135 Identity:56/136 (41%)
Similarity:86/136 (63%) Gaps:6/136 (4%)


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            |.:.:|:...|.::.|..:||..:|.:|:.:.|||||.|||.||||...|::.:..:|:.||||.
Zfish     6 DFRTQVDQSCRYSEEFINIYYECMDKKRRNLKRLYLDKATLVWNGNAVTGQEALGEFFESLPSSE 70

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAE----NDK--WKVVSDC 127
            .|:.|||.||:.:||...|...|::|:|||||...:.|.|.|.|::||:    :|:  ||:.|||
Zfish    71 FQVQTLDCQPVHEQATQGQTTLLVVAAGSVKFEGNKQRFFNQNFLLTAQASPNSDQPVWKIASDC 135

  Fly   128 YRMQE 132
            :|.|:
Zfish   136 FRFQD 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 54/127 (43%)
nxt2NP_001299841.1 NTF2 13..140 CDD:238403 54/127 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109857590
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4658
OMA 1 1.010
OrthoDB 1 1.010 D1450028at2759
OrthoFinder 1 1.000 FOG0002777
OrthoInspector 1 1.000 T1052861
orthoMCL 1 0.900 OOG5_130571
Panther 1 1.100 LDO PTHR12612
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2697
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.