DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and nxt2

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001299841.1 Gene:nxt2 / 751738 ZFINID:ZDB-GENE-050521-1 Length:143 Species:Danio rerio


Alignment Length:135 Identity:56/135 - (41%)
Similarity:86/135 - (63%) Gaps:6/135 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            |.:.:|:...|.::.|..:||..:|.:|:.:.|||||.|||.||||...|::.:..:|:.||||.
Zfish     6 DFRTQVDQSCRYSEEFINIYYECMDKKRRNLKRLYLDKATLVWNGNAVTGQEALGEFFESLPSSE 70

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAE----NDK--WKVVSDC 127
            .|:.|||.||:.:||...|...|::|:|||||...:.|.|.|.|::||:    :|:  ||:.|||
Zfish    71 FQVQTLDCQPVHEQATQGQTTLLVVAAGSVKFEGNKQRFFNQNFLLTAQASPNSDQPVWKIASDC 135

  Fly   128 YRMQE 132
            :|.|:
Zfish   136 FRFQD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 53/126 (42%)
nxt2NP_001299841.1 NTF2 13..140 CDD:238403 53/126 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593984
Domainoid 1 1.000 99 1.000 Domainoid score I7083
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4915
OMA 1 1.010 - - QHG56125
OrthoDB 1 1.010 - - D1450028at2759
OrthoFinder 1 1.000 - - FOG0004415
OrthoInspector 1 1.000 - - oto40253
orthoMCL 1 0.900 - - OOG6_104429
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2697
SonicParanoid 1 1.000 - - X4218
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.