DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and NXT1

DIOPT Version :8

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_037380.1 Gene:NXT1 / 29107 HGNCID:15913 Length:140 Species:Homo sapiens

Alignment Length:133 Identity:55/134 (41%)
Similarity:82/134 (61%) Gaps:4/134 (3%)


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            |.|..|:...|.|:.|..:||.::|.||:.:.|||:..|||.||||...|::.:..:|:.||||.
Human     5 DFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSE 69

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAE----NDKWKVVSDCYR 129
            .|::.:|.||:.|:|..:|...|::..|||||...:.|.|.|.||:||:    |..||:.|||:|
Human    70 FQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFR 134

  Fly   130 MQE 132
            .|:
Human   135 FQD 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 52/125 (42%)
NXT1NP_037380.1 NTF2 12..137 CDD:238403 52/125 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109874543
eggNOG 1 0.900 E1_KOG4353
Hieranoid 1 1.000
Homologene 1 1.000 H8301
Inparanoid 1 1.050 123 1.000 Inparanoid score I4658
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1450028at2759
OrthoFinder 1 1.000 FOG0002777
OrthoInspector 1 1.000 T609540
orthoMCL 1 0.900 OOG5_130571
Panther 1 1.100 O PTHR12612
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2697
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.