DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nxt1 and nxt2

Sequence 1:NP_611833.1 Gene:Nxt1 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001342808.1 Gene:nxt2 PomBaseID:SPAC15F9.03c Length:123 Species:Schizosaccharomyces pombe

Alignment Length:118 Identity:33/119 (28%)
Similarity:61/119 (51%) Gaps:8/119 (7%)


  Fly    16 ADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSS--NHQLNTLDAQP 78
            |..||:.||.:.|:.|.|:..||.:.:.||:.|....|.:.|......||..  .|:::||||||
pombe     8 ATQFTQFYYQTFDSDRSQLSSLYREESMLSFEGAQLQGTKAIVEKLVSLPFQRVQHRISTLDAQP 72

  Fly    79 IVDQAVSNQLAYLIMASGSVKFADQQL-RKFQQTFIVTAENDKWKVVSDCYRM 130
                 .....:.::|.:|.:...::|: :::.|.|.:...|..:.|::|.:|:
pombe    73 -----TGTTGSVIVMVTGELLLDEEQMAQRYSQVFHLVNNNGNYYVLNDLFRL 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 33/119 (28%)
nxt2NP_001342808.1 NTF2 3..122 CDD:238403 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12612
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.