DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and Nxt2

DIOPT Version :8

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001277461.1 Gene:Nxt2 / 237082 MGIID:2147914 Length:198 Species:Mus musculus

Alignment Length:133 Identity:55/134 (41%)
Similarity:80/134 (60%) Gaps:4/134 (3%)


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            :.|..|:...|.|:.|..:||.::|.||..:.|||||.|||.||||...|.:.:.::|:.||||.
Mouse    62 NFKTYVDQACRAAEEFVNIYYETMDKRRHALVRLYLDKATLIWNGNVVTGLEALANFFEMLPSSE 126

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAENDK----WKVVSDCYR 129
            .|:|.||.||:.:||...|...|::.||.|||...:...|.|.|::||::..    ||:.|||:|
Mouse   127 FQINMLDCQPVHEQATQCQTTVLVVTSGVVKFDGNKQHFFNQNFLLTAQSTPNSTVWKIASDCFR 191

  Fly   130 MQE 132
            .|:
Mouse   192 FQD 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 53/125 (42%)
Nxt2NP_001277461.1 NTF2 69..194 CDD:238403 53/125 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109865382
eggNOG 1 0.900 E1_KOG4353
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4723
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1450028at2759
OrthoFinder 1 1.000 FOG0002777
OrthoInspector 1 1.000 T616348
orthoMCL 1 0.900 OOG5_130571
Panther 1 1.100 LDO PTHR12612
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2697
TreeFam 1 0.960
1211.890

Return to query results.
Submit another query.