DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and nxt-1

DIOPT Version :8

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_491077.1 Gene:nxt-1 / 171866 WormBaseID:WBGene00003836 Length:137 Species:Caenorhabditis elegans

Alignment Length:128 Identity:39/129 (30%)
Similarity:67/129 (52%) Gaps:3/129 (2%)


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            ::..:.|.....:..|..:||..:|.:|::||.||...:...||||...|...|..:.:.|||:.
 Worm     8 EINKEDEELCNESKKFMDVYYDVMDRKREKIGFLYTQVSNAVWNGNPINGYDSICEFMKALPSTQ 72

  Fly    69 HQLNTLDAQPIVDQAVSNQLA--YLIMASGSVKFADQQLRKFQQTFIVTAENDKWKVVSDCYR 129
            |.:.:||||.: .:.|:..::  .|:..:|:|.......|.|.||.::..|:.|:||.||.:|
 Worm    73 HDIQSLDAQRL-PEGVTGDMSGGMLLNVAGAVTVDGDSKRAFTQTLLLGVEDGKYKVKSDRFR 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 38/122 (31%)
nxt-1NP_491077.1 NTF2 16..137 CDD:238403 38/121 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134522099
eggNOG 1 0.900 E1_KOG4353
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I3887
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1450028at2759
OrthoFinder 1 1.000 FOG0002777
OrthoInspector 1 1.000 T474594
orthoMCL 1 0.900 OOG5_130571
Panther 1 1.100 LDO PTHR12612
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2697
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.