DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and Pnp2

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_011243453.2 Gene:Pnp2 / 667034 MGIID:3712328 Length:337 Species:Mus musculus

Alignment Length:281 Identity:106/282 (38%)
Similarity:157/282 (56%) Gaps:6/282 (2%)


  Fly    45 YPFEEVEAMAKYIVNVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEPDCS--FV 107
            :.:|:.|..||:::..:..||:..:||||.|..:.:.::...:..|.:|||||.......:  .|
Mouse    52 FTYEDYETTAKWLLQHTEYRPQVAVICGSGLGGLTAHLKAAQIFDYNEIPNFPQSTVQGHAGRLV 116

  Fly   108 LGTVMGAPIIALVHSFHSCDGYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQD 172
            .|.:.|...:.:...||..:||:|:....||||..|.||.|:::|:.|..::..|.:|||||::|
Mouse   117 FGLLNGRSCVMMQGRFHMYEGYSLSEVTFPVRVFHLLGVETLVVTNAAGGLNPNFEVGDIMLIRD 181

  Fly   173 HINVVGMMHQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPI 237
            |||:.|...|.||.||:|.|||.|..:|.:|||:|:.:||....|:||.|:.|..|....:.||.
Mouse   182 HINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFSAWKQMGEQRKLQEGTYVMLAGPN 246

  Fly   238 LGTVAEERMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAFVVISR-AASDKESEESDKDKE-KDTD 300
            ..||||.|:|:.:...|||||.|||||.|.|.||:|..|.:|:. ...|.|:.|....|| .|..
Mouse   247 FETVAESRLLKMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNMVVMDYENLEKANHKEVLDAG 311

  Fly   301 RDSKQDKREQDS--QEPVPLP 319
            :.:.|......|  .|.:|||
Mouse   312 KAAAQKLERFVSILMESIPLP 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 93/232 (40%)
PNP_UDP_1 46..280 CDD:294213 94/236 (40%)
Pnp2XP_011243453.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32756918
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001519
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11904
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.