DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and mtap

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001011495.1 Gene:mtap / 496996 XenbaseID:XB-GENE-971776 Length:280 Species:Xenopus tropicalis

Alignment Length:289 Identity:67/290 (23%)
Similarity:114/290 (39%) Gaps:36/290 (12%)


  Fly    66 KYGLICGSFLSD---MVSLVEQPVVIPYEDIPNFPDGIEPDCSFVLGTVMGAPIIALV-----HS 122
            |.|:|.||.|.|   :...:|:.|..|:.         :|..:.|||.:.....:.|.     |:
 Frog     8 KVGIIGGSGLDDPDILEGRLEKYVDTPFG---------KPSDALVLGKIKNVDCVLLARHGRQHT 63

  Fly   123 FHSCD-GYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMMHQTPLE 186
            ....: .|.....||...     |...|::|:...::......|||::|...|:......||..:
 Frog    64 IAPTNVNYRANIWALKSE-----GCTHILVTTACGSLREEIQPGDIVIVDQFIDRTTKREQTFYD 123

  Fly   187 GPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHS-GVLACMGGPILGTVAEERMLRTM 250
            |......|.....|...:.....|..::|.||:||:  .|| |.:..:.||...:.||.:|.|..
 Frog   124 GGPSCLPGVCHIPMAEPFCAKTREVLIDIAKRLGIK--CHSKGAMITIEGPRFSSKAESQMFRLW 186

  Fly   251 EVSAVGMSLVPEVIAAHHGGLKVLAFVVISRAASDKESEESDKDKEKDTDRDSKQDKREQDSQEP 315
            ....:.|:.|||||.|...|:...:..:.:.....||.||:     ...||..|..|...:....
 Frog   187 GADVINMTTVPEVILAKEAGICYASIAMATDYDCWKEHEEA-----VSVDRVLKTLKENANKATS 246

  Fly   316 V---PLPRLQAC--SDLIGRLMYCMHLEI 339
            :   .:|::.|.  ::|:..:...:.|.:
 Frog   247 ILLTAIPQIAAMDWTELLQSMKSTVQLSV 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 55/224 (25%)
PNP_UDP_1 46..280 CDD:294213 55/224 (25%)
mtapNP_001011495.1 PNP_UDP_1 7..256 CDD:320888 64/269 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.