DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and MTAP

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_002442.2 Gene:MTAP / 4507 HGNCID:7413 Length:283 Species:Homo sapiens

Alignment Length:240 Identity:53/241 (22%)
Similarity:96/241 (40%) Gaps:34/241 (14%)


  Fly    66 KYGLICGSFLSDMVSLVEQPVVI-----PYEDIPNFPDGIEPDCSFVLGTVMGAPIIALVHSFHS 125
            |.|:|.|:.|.|       |.::     .|.|.| |.   :|..:.:||.:.....:.|..    
Human    11 KIGIIGGTGLDD-------PEILEGRTEKYVDTP-FG---KPSDALILGKIKNVDCVLLAR---- 60

  Fly   126 CDGYNLATCALPVRV--------MQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMMHQ 182
               :......:|.:|        ::..|...:::|:...::......|||:::...|:...|..|
Human    61 ---HGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQ 122

  Fly   183 TPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHS-GVLACMGGPILGTVAEERM 246
            :..:|......|.....|...:.....|..:|..|::|::  .|| |.:..:.||...:.||..|
Human   123 SFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLR--CHSKGTMVTIEGPRFSSRAESFM 185

  Fly   247 LRTMEVSAVGMSLVPEVIAAHHGGLKVLAFVVISRAASDKESEES 291
            .||.....:.|:.||||:.|...|:...:..:.:.....||.||:
Human   186 FRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEA 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 49/228 (21%)
PNP_UDP_1 46..280 CDD:294213 49/228 (21%)
MTAPNP_002442.2 PNP_UDP_1 10..273 CDD:320888 53/241 (22%)
Phosphate binding 60..61 0/8 (0%)
Phosphate binding 93..94 0/1 (0%)
Substrate binding 220..222 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.