DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and pnp5b

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001004628.1 Gene:pnp5b / 447889 ZFINID:ZDB-GENE-040912-54 Length:294 Species:Danio rerio

Alignment Length:262 Identity:98/263 (37%)
Similarity:149/263 (57%) Gaps:4/263 (2%)


  Fly    39 TPQSLF-YPFEEVEAMAKYIVNVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEP 102
            ||.|.. |.:||..|.|.:::..:..||..|::|||.|..:..:::..:||.|.||||||.....
Zfish     2 TPDSATGYSYEECTATADWLLKRAPERPLVGIVCGSGLGGLAKMLKDELVINYCDIPNFPQSTVH 66

  Fly   103 DCS--FVLGTVMGAPIIALVHSFHSCDGYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALG 165
            ..:  .|.||:.|.|.:.:...||..:||.:....:|:||.:|.||.|::||:.|..::..|.:|
Zfish    67 GHAGKLVFGTLKGKPCVCMQGRFHLYEGYAIQKTTMPIRVFKLMGVETVILTNAAGGLNQDFKVG 131

  Fly   166 DIMLVQDHINVVGMMHQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVL 230
            |||:::||||:.|.....||.|.:|.|||.|...|.:|||:||.:....:...:....|:..||.
Zfish   132 DIMIIKDHINIPGFAGHNPLVGANDDRFGVRFPCMSDAYDRDLQQLVRAVADELDFSVFMRDGVY 196

  Fly   231 ACMGGPILGTVAEERMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAF-VVISRAASDKESEESDKD 294
            :.:|||...|:||.|.||.:...|||||.|.|||.|.|..::|||. ::.::|..|.:||:....
Zfish   197 SVLGGPSFETIAECRALRQLGADAVGMSTVHEVIVARHCDMRVLALSLITNKAVMDYQSEKKANH 261

  Fly   295 KE 296
            :|
Zfish   262 EE 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 87/233 (37%)
PNP_UDP_1 46..280 CDD:294213 89/237 (38%)
pnp5bNP_001004628.1 PRK08202 11..286 CDD:236183 94/254 (37%)
XapA 16..286 CDD:223084 92/249 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32333279
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1078969at2759
OrthoFinder 1 1.000 FOG0001519
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11904
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.