| Sequence 1: | NP_611822.1 | Gene: | CG18128 / 37756 | FlyBaseID: | FBgn0034898 | Length: | 339 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001004628.1 | Gene: | pnp5b / 447889 | ZFINID: | ZDB-GENE-040912-54 | Length: | 294 | Species: | Danio rerio |
| Alignment Length: | 262 | Identity: | 98/262 - (37%) |
|---|---|---|---|
| Similarity: | 149/262 - (56%) | Gaps: | 4/262 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 39 TPQSLF-YPFEEVEAMAKYIVNVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEP 102
Fly 103 DCS--FVLGTVMGAPIIALVHSFHSCDGYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALG 165
Fly 166 DIMLVQDHINVVGMMHQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVL 230
Fly 231 ACMGGPILGTVAEERMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAF-VVISRAASDKESEESDKD 294
Fly 295 KE 296 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG18128 | NP_611822.1 | PNP_UDP_1 | 46..280 | CDD:294213 | 89/236 (38%) |
| XapA | 50..280 | CDD:223084 | 87/232 (38%) | ||
| pnp5b | NP_001004628.1 | PRK08202 | 11..286 | CDD:236183 | 94/253 (37%) |
| XapA | 16..286 | CDD:223084 | 92/248 (37%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG58962 | |
| OrthoDB | 1 | 1.010 | - | - | D1078969at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001804 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR11904 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X1164 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 6.030 | |||||