DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and pnp4a

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001002102.1 Gene:pnp4a / 415192 ZFINID:ZDB-GENE-040625-83 Length:291 Species:Danio rerio

Alignment Length:247 Identity:85/248 (34%)
Similarity:138/248 (56%) Gaps:6/248 (2%)


  Fly    48 EEVEAMAKYIVNVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEPDCS--FVLGT 110
            |:.:..|.::::.:..|||..:||||.|..:...::......|.|||.||.......:  .|.|.
Zfish    10 EDYQRAADWLLSQTQHRPKVAIICGSGLGMLADGLKCQDSFKYSDIPGFPQSTVKGHAGRLVFGE 74

  Fly   111 VMGAPIIALVHSFHSCDGYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHIN 175
            :.|...:.:...||..:|::|:....||||.:|.||.|:::|:.|.::...:..||||:::||||
Zfish    75 LKGKTCVCMQGRFHMYEGHSLSKVTFPVRVFKLLGVDTLIVTNAAGSLADSYNCGDIMIIRDHIN 139

  Fly   176 VVGMMHQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPILGT 240
            ..|:....||.||:|.:||.|...|...||:.|.:.||:|.|.||:.:::..||...:|||...:
Zfish   140 FPGLAGLNPLNGPNDEKFGPRFPPMSGVYDRGLRKMALDICKGMGVSQYVQEGVYCMVGGPNFES 204

  Fly   241 VAEERMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAFVVIS----RAASDKES 288
            :||.|:|..:.|.|||||..|||:.|.|.|::|....:|:    ::..|.|:
Zfish   205 IAEARLLHRLGVDAVGMSTAPEVLVASHCGIRVFGLSLITNKVVKSYEDNET 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 82/232 (35%)
PNP_UDP_1 46..280 CDD:294213 83/234 (35%)
pnp4aNP_001002102.1 PRK08202 9..284 CDD:236183 85/248 (34%)
XapA 13..284 CDD:223084 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1078969at2759
OrthoFinder 1 1.000 FOG0001519
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11904
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.