DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and pnp4b

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_991206.1 Gene:pnp4b / 402940 ZFINID:ZDB-GENE-040426-1887 Length:304 Species:Danio rerio

Alignment Length:253 Identity:94/254 (37%)
Similarity:140/254 (55%) Gaps:3/254 (1%)


  Fly    47 FEEVEAMAKYIVNVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEP--DCSFVLG 109
            |::.:...:::::.:..|||..::|||.|..:...|.......||||||||....|  :...|.|
Zfish    12 FDDCKLTTEWLLSRTRHRPKIAVVCGSGLGLLADNVPNKQSFRYEDIPNFPVSTVPGHEGCLVFG 76

  Fly   110 TVMGAPIIALVHSFHSCDGYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHI 174
            .:.|...:.:...||..:||:|.....|||:.:|.||.||::|:.:..:...|.:||||:::|||
Zfish    77 QIKGKSCVFMQGRFHLYEGYSLCKVTFPVRIFKLMGVETIIVTNASGGLCQDFKVGDIMVIKDHI 141

  Fly   175 NVVGMMHQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPILG 239
            |:.|...|.||.||:|.|||.|...|.:||.|||.:..::|...:|...|:|.||...:.||...
Zfish   142 NLPGFAGQHPLCGPNDERFGIRFPCMSDAYSKDLRKLVMDITAELGYSNFVHEGVYCMVSGPNFE 206

  Fly   240 TVAEERMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAFVVISRAAS-DKESEESDKDKE 296
            |:||.|||..:...:||||.||||..|.|.||:|:...:|:...| |...||....:|
Zfish   207 TIAEARMLHILGSDSVGMSTVPEVTVAKHCGLRVMGLSLITNKVSLDYSREEKVNHEE 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 88/232 (38%)
PNP_UDP_1 46..280 CDD:294213 89/235 (38%)
pnp4bNP_991206.1 PRK08202 18..286 CDD:236183 93/248 (38%)
XapA 25..286 CDD:223084 93/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1078969at2759
OrthoFinder 1 1.000 FOG0001519
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11904
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.