DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and mtap

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_956848.1 Gene:mtap / 393526 ZFINID:ZDB-GENE-040426-1505 Length:280 Species:Danio rerio

Alignment Length:294 Identity:69/295 (23%)
Similarity:113/295 (38%) Gaps:53/295 (18%)


  Fly    61 SHIRPKYGLICGSFLSD---MVSLVEQPVVIPYEDIPNFPDGIEPDCSFVLGTVMGAPIIALV-- 120
            ||:  |.|:|.||.|.|   :....|:.||.||.         :|..:.:||.:.....:.|.  
Zfish     5 SHV--KIGIIGGSGLDDPDILEGRTERYVVTPYG---------KPSDALILGKIKNVDCVLLARH 58

  Fly   121 ---HSFHSCD-GYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMMH 181
               |:....: .|.....||...     |...:::|:...::......|||:|:...|:......
Zfish    59 GRQHTIMPTNVNYQANIWALKEE-----GCTHLLVTTACGSLREDIQPGDIVLIDQFIDRTTKRV 118

  Fly   182 QTPLEG-PSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHS-GVLACMGGPILGTVAEE 244
            ||..:| |:.|. |.....|...:.....|..||:.:.:|::  .|: |.:..:.||...:.||.
Zfish   119 QTFYDGQPTSPP-GVCHIPMAEPFCSKTREVLLEVAQGLGVK--CHTRGTMVTIEGPRFSSRAES 180

  Fly   245 RMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAFVVISRAASDKESEES------------DKDKEK 297
            .|.|......:.|:.||||:.|...||...:..:.:.....||.||:            :.:|..
Zfish   181 LMFRQWGADVINMTTVPEVVLAKEAGLCYASIAMATDYDCWKEHEEAVCVDNVLKTMKENANKAS 245

  Fly   298 -----------DTDRDSKQDKREQDSQEPVPLPR 320
                       ..|.||..:..:..||..|.||:
Zfish   246 SILLTAIPQICQMDWDSTINAHKSMSQSSVMLPK 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 56/230 (24%)
PNP_UDP_1 46..280 CDD:294213 56/230 (24%)
mtapNP_956848.1 PNP_UDP_1 7..255 CDD:294213 59/267 (22%)
XapA 7..255 CDD:223084 59/267 (22%)
Phosphate binding. {ECO:0000255|HAMAP-Rule:MF_03155} 57..58 0/1 (0%)
Phosphate binding. {ECO:0000255|HAMAP-Rule:MF_03155} 90..91 0/1 (0%)
Substrate binding. {ECO:0000255|HAMAP-Rule:MF_03155} 217..219 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.