DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and CG31115

DIOPT Version :8

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_733068.2 Gene:CG31115 / 318597 FlyBaseID:FBgn0051115 Length:290 Species:Drosophila melanogaster

Alignment Length:228 Identity:53/229 (23%)
Similarity:85/229 (37%) Gaps:50/229 (22%)


  Fly    66 KYGLICGSFLSDMVSLVEQ---PVVIPYEDIPNFPDGIEPDCSFVLGTVMGAPIIALVHSFHSCD 127
            |.|:|..:.|...:.|.|:   .|..|:.         :|....:.|.:.|..:..|..:..:.|
  Fly    19 KIGIIGEANLDKPIYLAERMEYAVCTPFG---------KPSDVIIDGQIEGVNVCLLSRNGRNHD 74

  Fly   128 GYNLATCALP--------VRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMMHQTP 184
                   .:|        |..|:..|...|::|:..:::...|..|.:::..|.|:......||.
  Fly    75 -------IMPSNINYRANVWAMRKMGCTHILVTNTFSSLRDTFQPGHLVVPNDVIDYTSRRAQTF 132

  Fly   185 LEG-----------PSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPIL 238
            .:|           |.:|.|..|.       .:.||..|.|:|...|     .||.:..:.||..
  Fly   133 YDGAVGSPLGVCHVPMNPTFCERT-------RQHLLSAAEELGFPTG-----SSGTVLTLEGPRY 185

  Fly   239 GTVAEERMLRTMEVSAVGMSLVPEVIAAHHGGL 271
            .||||..|.|......:.|:|.||.|.|...|:
  Fly   186 STVAENNMFRKWGADLLSMTLCPEAILAKEAGI 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 XapA 50..280 CDD:223084 53/229 (23%)
PNP_UDP_1 46..280 CDD:294213 53/229 (23%)
CG31115NP_733068.2 XapA 12..266 CDD:223084 53/229 (23%)
PNP_UDP_1 19..264 CDD:294213 53/229 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C33388484
eggNOG 1 0.900 E1_COG0005
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.