DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg3 and Alg3

Sequence 1:NP_523829.2 Gene:Alg3 FlyBaseID:FBgn0011297 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001135835.1 Gene:Alg3 RGDID:1306004 Length:438 Species:Rattus norvegicus

Alignment Length:456 Identity:206/457 (45%)
Similarity:260/457 (57%) Gaps:80/457 (18%)


  Fly    36 KYLLL-EPAALPIVGLFVLLAELVINVVVIQRVPYTEIDWVAYMQECEGFLNGTTNYSLLRGDTG 99
            :|||| ||....:|...:.|||:.|...||.||.||||||.|||.:.|||:|||.:|:.|:||||
  Rat    32 RYLLLREPRYTLMVASCLCLAEVGITFWVIHRVAYTEIDWKAYMAQVEGFINGTYDYTQLQGDTG 96

  Fly   100 PLVYPAAFVYIYSALYYVTSHGTNVRLAQYIFAGIYLLQLALVLRLYSKSRKVPPYVLVLSAFTS 164
            ||||||.|:||::.|||.|..||::..||.|||.:||:.|.||..:|.::.||||:|.......|
  Rat    97 PLVYPAGFLYIFTGLYYATDRGTDIPTAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCAS 161

  Fly   165 YRIHSIYVLRLFNDPVAVLLLYAALNLFLDRRWTLGSTFFSLAVGVKMNILLFAPALLLFYLANL 229
            ||:|||:||||||||||:.||:.::||||.:||:.|...|||||.||||:|||||.||...|...
  Rat   162 YRVHSIFVLRLFNDPVAMALLFLSVNLFLAQRWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQF 226

  Fly   230 GLLRTILQLAVCGVIQLLLGAPFLLTHPVEYLRGSFDLGRIFEHKWTVNYRFLSRDLFENRTFHV 294
            |....:.:||:|..:|::||.||||.:||.||..||||||.|.::||||:|.|...:|.:|.||:
  Rat   227 GFRGALPKLALCAALQVVLGLPFLLENPVGYLSRSFDLGRQFLYQWTVNWRLLPEAIFLHRAFHL 291

  Fly   295 SLLGLHLLLLLAFAKPTWTFFQSYVRLRRIEDQLQPQIAQQNLELNAQKRPKKVEKDKDKDQKKF 359
            :||..||..||.||...|         .|..:.:          |:..|.|.|            
  Rat   292 ALLAAHLSFLLLFALCRW---------HRTGESI----------LSLLKDPSK------------ 325

  Fly   360 TTEQQSFLKAFEKSLQKASGGKATPAPAQAEPERYGIHFDRCTQLALLP------FFLCNLVGVA 418
                                .|..|.|                   |.|      .|..|.:||.
  Rat   326 --------------------RKVPPQP-------------------LTPNQIVSVLFTSNFIGVC 351

  Fly   419 CSRSLHYQFYVWYFHSLPYLAWSTP---YSLGVRCLILGLIEYCWNTYPSTNFSSAALHFTHIIL 480
            .|||||.||||||||:||:|.|:||   .:..:|.|:|||||..|||||||.|||||||..|.:.
  Rat   352 FSRSLHSQFYVWYFHTLPHLLWATPARWLTHLLRLLVLGLIELSWNTYPSTPFSSAALHLCHAVT 416

  Fly   481 L 481
            |
  Rat   417 L 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg3NP_523829.2 ALG3 51..470 CDD:282992 192/428 (45%)
Alg3NP_001135835.1 ALG3 49..406 CDD:282992 153/363 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188551957
eggNOG 1 0.900 E1_KOG2762
Hieranoid 1 1.000
Homologene 1 1.000 H4228
Inparanoid 1 1.050 393 1.000 Inparanoid score I1883
OMA 1 1.010
OrthoDB 1 1.010 D443928at33208
OrthoFinder 1 1.000 FOG0004501
OrthoInspector 1 1.000 T1086502
orthoMCL 1 0.900 OOG5_129230
Panther 1 1.100 LDO PTHR12646
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.