DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg3 and alg3

Sequence 1:NP_523829.2 Gene:Alg3 FlyBaseID:FBgn0011297 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_593853.1 Gene:alg3 PomBaseID:SPAC7D4.06c Length:406 Species:Schizosaccharomyces pombe

Alignment Length:469 Identity:160/470 (34%)
Similarity:227/470 (48%) Gaps:89/470 (19%)


  Fly    37 YLLLEPAALPIVGLFVLLAELVINVVVIQRVPYTEIDWVAYMQECEGFLNGTTNYSLLRGDTGPL 101
            |..|.|:.|       ||.|:.....:|.:||||||||:|||::...||.|..:|..|.|.||||
pombe    22 YGWLHPSRL-------LLLEIPFVFAIISKVPYTEIDWIAYMEQVNSFLLGERDYKSLVGCTGPL 79

  Fly   102 VYPAAFVYIYSALYYVTSHGTNVRLAQYIFAGIYLLQLALVLRLYSKSRKVPPYVLVLSAFTSYR 166
            |||...|::|:.|||:|..|||:..||||||.:|.:..|:|..|: |..:.|.|:.|| ...|.|
pombe    80 VYPGGHVFLYTLLYYLTDGGTNIVRAQYIFAFVYWITTAIVGYLF-KIVRAPFYIYVL-LILSKR 142

  Fly   167 IHSIYVLRLFNDPVAVLLLYAALNLFL----DRRWTLGSTFFSLAVGVKMNILLFAPALLLFYLA 227
            :|||::||||||....|.    .:||:    .::|...|...|:|..|||:.||:.||.|:..|.
pombe   143 LHSIFILRLFNDGFNSLF----SSLFILSSCKKKWVRASILLSVACSVKMSSLLYVPAYLVLLLQ 203

  Fly   228 NLGLLRTILQLAVCGVIQLLLGAPFLLTHPVEYLRGSFDLGRIFEHKWTVNYRFLSRDLFENRTF 292
            .||..:|.:.:.|..::|:|...|| |.:...|...:||.||.|::|||||:||:.|.:||:.:|
pombe   204 ILGPKKTWMHIFVIIIVQILFSIPF-LAYFWSYWTQAFDFGRAFDYKWTVNWRFIPRSIFESTSF 267

  Fly   293 HVSLLGLHLLLLLAFAKPTWTFFQSYVRLRRIEDQLQPQIAQQNLELNAQKRPKKVEKDKDKDQK 357
            ..|:|.||:.||:||....|.      :|.|     ....|..|..|..:..||           
pombe   268 STSILFLHVALLVAFTCKHWN------KLSR-----ATPFAMVNSMLTLKPLPK----------- 310

  Fly   358 KFTTEQQSFLKAFEKSLQKASGGKATPAPAQAEPERYGIHFDRCTQLALLPFFLCNLVGVACSRS 422
                            ||.|:......|.|.:                       ||:|:.|:||
pombe   311 ----------------LQLATPNFIFTALATS-----------------------NLIGILCARS 336

  Fly   423 LHYQFYVWYFHSLPYLAWSTPYSLGVRCLILGLIEYCWNTYPSTNFSSAALHFTHIILLAGVAKQ 487
            ||||||.|:....|||.:...:...:...:..|.||.||.:|||..||          |..|...
pombe   337 LHYQFYAWFAWYSPYLCYQASFPAPIVIGLWMLQEYAWNVFPSTKLSS----------LIAVCVP 391

  Fly   488 LVQTMRINNAAKRE 501
            |:..:::..:..|:
pombe   392 LITILKLYTSDYRK 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg3NP_523829.2 ALG3 51..470 CDD:282992 151/423 (36%)
alg3NP_593853.1 ALG3 30..384 CDD:282992 152/429 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H4228
Inparanoid 1 1.050 269 1.000 Inparanoid score I700
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004501
OrthoInspector 1 1.000 T1124618
orthoMCL 1 0.900 OOG5_129230
Panther 1 1.100 LDO PTHR12646
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R42
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.