DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alg3 and Alg3

Sequence 1:NP_523829.2 Gene:Alg3 FlyBaseID:FBgn0011297 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_666051.2 Gene:Alg3 MGIID:1098592 Length:438 Species:Mus musculus

Alignment Length:456 Identity:203/457 (44%)
Similarity:264/457 (58%) Gaps:80/457 (18%)


  Fly    36 KYLLL-EPAALPIVGLFVLLAELVINVVVIQRVPYTEIDWVAYMQECEGFLNGTTNYSLLRGDTG 99
            :|||| ||....:|...:.:||:.|...||.||.||||||.|||.:.|||:|||.:|:.|:||||
Mouse    32 RYLLLREPRYTLLVASCLCIAEVGITFWVIHRVAYTEIDWKAYMAQVEGFINGTYDYTQLQGDTG 96

  Fly   100 PLVYPAAFVYIYSALYYVTSHGTNVRLAQYIFAGIYLLQLALVLRLYSKSRKVPPYVLVLSAFTS 164
            ||||||.|:||::.|:|.|..||::.:||.|||.:||:.|.||..:|.::.||||:|.......|
Mouse    97 PLVYPAGFLYIFTGLFYATDRGTDIPMAQNIFAVLYLVTLVLVFLIYHQTSKVPPFVFFFMCCAS 161

  Fly   165 YRIHSIYVLRLFNDPVAVLLLYAALNLFLDRRWTLGSTFFSLAVGVKMNILLFAPALLLFYLANL 229
            ||:|||:||||||||||:.||:.::||||.:.|:.|...|||||.||||:|||||.||...|...
Mouse   162 YRVHSIFVLRLFNDPVAMALLFLSINLFLAQCWSWGCCCFSLAVSVKMNVLLFAPGLLFLLLTQF 226

  Fly   230 GLLRTILQLAVCGVIQLLLGAPFLLTHPVEYLRGSFDLGRIFEHKWTVNYRFLSRDLFENRTFHV 294
            |....:.:||:|..:|::||.||||.:|:.||..||||||.|..:||||:|||...:|.:|.||:
Mouse   227 GFRGALPKLAICAALQVVLGLPFLLENPIGYLSRSFDLGRQFLFQWTVNWRFLPETIFLHRAFHL 291

  Fly   295 SLLGLHLLLLLAFAKPTWTFFQSYVRLRRIEDQLQPQIAQQNLELNAQKRPKKVEKDKDKDQKKF 359
            :||..||.|||.||...|         .|..:.:...:                   ||..::| 
Mouse   292 ALLAAHLSLLLLFALCRW---------HRTGESILALL-------------------KDPSKRK- 327

  Fly   360 TTEQQSFLKAFEKSLQKASGGKATPAPAQAEPERYGIHFDRCTQLALLP------FFLCNLVGVA 418
                                     .|.|                ||.|      .|..|.:|:.
Mouse   328 -------------------------VPPQ----------------ALTPNQIVSILFTSNFIGIC 351

  Fly   419 CSRSLHYQFYVWYFHSLPYLAWSTP---YSLGVRCLILGLIEYCWNTYPSTNFSSAALHFTHIIL 480
            .||||||||||||||:||||.|:.|   .:..:|.|:|||||..|||||||:|||||||..|.::
Mouse   352 FSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSFSSAALHLCHAVV 416

  Fly   481 L 481
            |
Mouse   417 L 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alg3NP_523829.2 ALG3 51..470 CDD:282992 189/428 (44%)
Alg3NP_666051.2 ALG3 49..406 CDD:282992 150/363 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C188551900
eggNOG 1 0.900 E1_KOG2762
Hieranoid 1 1.000
Homologene 1 1.000 H4228
Inparanoid 1 1.050 397 1.000 Inparanoid score I1937
Isobase 1 0.950 0 Normalized mean entropy S1761
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004501
OrthoInspector 1 1.000 T1082918
orthoMCL 1 0.900 OOG5_129230
Panther 1 1.100 LDO PTHR12646
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R42
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.