DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and ANGEL2

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_653168.2 Gene:ANGEL2 HGNCID:30534 Length:544 Species:Homo sapiens

Alignment Length:388 Identity:120/389 (31%)
Similarity:167/389 (43%) Gaps:84/389 (22%)


  Fly    10 SLKATSRIIRRSVSSQAKG---ASGKRKQKAK-----EMESSHDRNRRWTSLGNQAEGRDPHKCS 66
            :|..||.|...|....|:|   :|.:||.:..     |...|||:.:. ..||:  :..|| ||.
Human    99 NLSQTSLIHLSSYVMNAEGDEPSSKRRKHQGVIKRNWEYICSHDKEKT-KILGD--KNVDP-KCE 159

  Fly    67 ------SFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFD 125
                  .|.|:|||||:||||.::..||.......|.|..|..|:|:|:...|.|:|||||:|.|
Human   160 DSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQED 224

  Fly   126 HL-----PVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVAL 183
            |.     |.|         :.|.|  .||.:||.:.|||||.:..|||.||....||.:...::|
Human   225 HYGAEIRPSL---------ESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISL 280

  Fly   184 LNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFS-----TDTP 243
            |:||||.|....:.|..........||.||||:|.:|.|::..|:..:|.|:.|.:     :..|
Human   281 LDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCP 345

  Fly   244 IVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPLHFEI-------------- 282
            ||:.|||||:|.|....|:           :|| :|...|:.....|...|              
Human   346 IVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYE 410

  Fly   283 ---------IDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYS-------LPSINRC 329
                     .||........|.|.::.   ...|.|..:|.....||||       :|.:..|
Human   411 VQQVPKVEKTDSDLTQTQLKQTEVLVT---AEKLSSNLQHHFSLSSVYSHYFPDTGIPEVTTC 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 99/315 (31%)
ANGEL2NP_653168.2 EEP 169..542 CDD:321002 99/315 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84063973
eggNOG 1 0.900 E1_COG5239
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4513
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D395901at33208
OrthoFinder 1 1.000 FOG0002391
OrthoInspector 1 1.000 T609071
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12121
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.