DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and NGL2

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_014012.1 Gene:NGL2 SGDID:S000004898 Length:515 Species:Saccharomyces cerevisiae

Alignment Length:467 Identity:98/468 (21%)
Similarity:169/468 (36%) Gaps:144/468 (31%)


  Fly     7 HNVSLKATSRIIRRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAEGRDPHKCSSFKVV 71
            |...::|...::|:: ...|..|.|.......|:   |...|.:.|| ::||   |.....||::
Yeast    59 HIAKVRAEREVMRKA-KRDAMLAQGVDPDCPPEL---HFIRRPFLSL-HEAE---PVTGFRFKLM 115

  Fly    72 SYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRM 136
            :||.|||.|:...||...|   :.|.|.||.:.||.|....:.|::||||:  ||  :..|....
Yeast   116 TYNCLAQALIRRKLFPDSG---DALKWYRRSKVLLNEFKYYNSDVICLQEI--DH--IQFQSFWK 173

  Fly   137 GNGKKLAY---VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQ--AVALLNR---DNVALFA 193
            ....||.|   .|:..|  :..|.||::....|..:|...:: ||:  :.::..|   :||.|..
Yeast   174 DEFSKLGYDGQYYRNAT--KNHGVAIMWRRELFHQVDKMLID-YDKESSESISTRTTTNNVGLVL 235

  Fly   194 RFRFK--------KQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTDTPIV----- 245
            ..:|.        |:..::...::.||||.::...:..|..|...:|::::.|.....::     
Yeast   236 ALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNEND 300

  Fly   246 ---------LTGDFNSLP--------DSSPIEF------LVG--------------------KNG 267
                     ..|||||.|        .|.|:.:      ::|                    :.|
Yeast   301 GDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGADDEEGG 365

  Fly   268 DVD-------STACPEPLH-----FEIIDS----------------------------------G 286
            :::       .:..||..|     .|::|.                                  |
Yeast   366 NIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRG 430

  Fly   287 EGTASTYQNEW-VIVDYI--------------LRSLGS-RSRHKLLPLSVYSLPSINRCIGAGQI 335
            |...|.:.|.| .::||:              :.:||. ...:|:.......:|..|.....||.
Yeast   431 EPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHGQP 495

  Fly   336 PNYRLGSDHYAL 347
            ......|||.::
Yeast   496 HVGEYASDHLSM 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 82/405 (20%)
NGL2NP_014012.1 CCR4 82..515 CDD:227564 93/444 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84152519
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.