| Sequence 1: | NP_477204.1 | Gene: | angel / 37748 | FlyBaseID: | FBgn0016762 | Length: | 354 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014600.1 | Gene: | NGL1 / 854115 | SGDID: | S000005402 | Length: | 363 | Species: | Saccharomyces cerevisiae | 
| Alignment Length: | 380 | Identity: | 90/380 - (23%) | 
|---|---|---|---|
| Similarity: | 137/380 - (36%) | Gaps: | 118/380 - (31%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    59 GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLK-LDPDILCLQEM 122 
  Fly   123 -------------------------------------------------QFDHLP----VLVQRL 134 
  Fly   135 RMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKK 199 
  Fly   200 QQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSF-----------STDTPIVLTGDFNSL 253 
  Fly   254 PDSSPIEFLVGK---NGDVD--------STAC-----PEPLHFEIIDSGEGTASTYQNEWV-IVD 301 
  Fly   302 YILRSL--GSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGAVFTVV 354 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| angel | NP_477204.1 | EEP | 70..351 | CDD:294334 | 86/364 (24%) | 
| NGL1 | NP_014600.1 | CCR4 | 1..363 | CDD:227564 | 90/378 (24%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5239 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||