DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: angel and CCR4

Sequence 1:NP_477204.1 Gene:angel FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_009381.1 Gene:CCR4 SGDID:S000000019 Length:837 Species:Saccharomyces cerevisiae

Alignment Length:382 Identity:99/383 (26%)
Similarity:151/383 (39%) Gaps:100/383 (26%)


  Fly    39 EMESSHDRNRRWTSLGNQAE--GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRR 101
            |:.:..:..|.:.||....|  ..|..| .:|.|:|||.|.|......::.|.  |...|||..|
Yeast   475 EINTDGEPQREYDSLQQSTEHLATDLAK-RTFTVLSYNTLCQHYATPKMYRYT--PSWALSWDYR 536

  Fly   102 QQNLLRELLKLDPDILCLQEMQ---FDH--LPVLVQRLRMG--NGKKLAYVYKKKTGCRTDGCAI 159
            :..|..::|..|.|:|||||::   |:.  :|:|.:....|  :.|..|.....|...:.|||.|
Yeast   537 RNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCI 601

  Fly   160 VYDSSKFELLDHQAVEL-------------YDQAVALLNRDNVALFARFRFKKQQEQQKEFVVA- 210
            .:...:|:|:...|::.             .|.....:|:||||||    .|.|.....:.:.| 
Yeast   602 FFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALF----LKLQHIPSGDTIWAV 662

  Fly   211 TTHLLFNTKRSDVRCAQVERILEELQ---------SFSTDT---PIVLTGDFNSLPDSSPIEFLV 263
            ||||.::.|.:||:..||..:|:.|:         :|..|.   |:::.|||||..:|:..|.: 
Yeast   663 TTHLHWDPKFNDVKTFQVGVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVYELI- 726

  Fly   264 GKNGDVDSTACPEPLHFEIIDSGEGTASTYQNE----------------------------WVIV 300
             ..|.|           :|...|.|....|.:|                            ..::
Yeast   727 -NTGRV-----------QIHQEGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVI 779

  Fly   301 DYI------LRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGAVF 351
            |||      ||..|.        |.......:::.||   .||.:..|||..|.|.|
Yeast   780 DYIWFSTHALRVRGL--------LGEVDPEYVSKFIG---FPNDKFPSDHIPLLARF 825

Known Domains:


GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 90/348 (26%)
CCR4NP_009381.1 leucine-rich repeat 339..358 CDD:275378
LRR_8 359..438 CDD:290566
LRR_4 359..397 CDD:289563
leucine-rich repeat 359..381 CDD:275378
LRR_4 381..419 CDD:289563
leucine-rich repeat 382..404 CDD:275378
leucine-rich repeat 405..427 CDD:275378
leucine-rich repeat 428..439 CDD:275378
CCR4 476..837 CDD:227564 98/382 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.